Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: psesp-Q9RBY1

Pseudomonas sp. MIS38 lipase

Comment
The N-catalytic domain (residues 1370) contains the active site residues, Ser207, Asp255, and His313 4, 5. The C-domain contains several repeats of the RTX motif and a putative secretion signal near the C-terminus. The C-domain contains two beta-roll motifs, laterally stacked together forming the so-called roll sandwich. The first -roll motif consists of residues 373417, containing five RTX repeats and binds three Ca2+ ions. The second beta-roll motif consists of residues 493-568, containing eight RTX repeats and binds five Ca2+ ions. HemolysinCabind (PF00353)


Relationship
Family|Bacterial_lip_FamI.3
Block| L
Position in NCBI Life Tree|Pseudomonas sp. MIS38
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas sp. MIS38: N E


Molecular evidence
Database
No mutation
7 structures (e.g. : 2Z8X, 2Z8Z, 2ZJ6... more)
No kinetic





3 substrates: Tributyrin, Trihexanoin, Trioctanoin
1 inhbitor:
Paraoxon
2 Genbank : AB025596, BAA84997
>3 Structure links 4 more: 2ZVD, 2ZJ6, 2ZJ7
1 UniProt : Q9RBY1
1 Interpro : Q9RBY1
1 Prodom : Q9RBY1
1 Pfam : Q9RBY1
1 PIRSF : Q9RBY1
1 SUPERFAM : Q9RBY1
Sequence
Graphical view for this peptide sequence: psesp-Q9RBY1
Colored MSA for Bacterial_lip_FamI.3 (raw)
MGVYDYKNFGTADSKALFSDAMAITLYSYHNLDNGFAAGYQHNGFGLGLP
ATLVTALLGGTDSQGVIPGIPWNPDSEKLALDAVKKAGWTPITASQLGYD
GKTDARGTFFGEKAGYTTAQVEILGKYDAQGHLTEIGIAFRGTSGPRENL
ILDSIGDVINDLLAAFGPKDYAKNYVGEAFGNLLNDVVAFAKANGLSGKD
VLVSGHSLGGLAVNSMADLSGGKWGGFFADSNYIAYASPTQSSTDKVLNV
GYENDPVFRALDGSTFTGASVGVHDAPKESATDNIVSFNDHYASTAWNLL
PFSILNIPTWISHLPTAYGDGMNRIIESKFYDLTSKDSTIIVANLSDPAR
ANTWVQDLNRNAETHKGSTFIIGSDSNDLIQGGSGNDYLEGRAGNDTFRD
GGGYNVILGGAGNNTLDLQKSVNTFDFANDGAGNLYVRDANGGISITRDI
GSIVTKEPGFLWGLFKDDVTHSVTASGLKVGSNVTQYDASVKGTNGADTL
KAHAGGDWLFGLDGNDHLIGGVGNDVFVGGAGNDLMESGGGADTFLFNGA
FGQDRVVGFTSNDKLVFLGVQGVLPNDDFRAHASMVGQDTVLKFGGDSVT
LVGVALNSLSADGIVIA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGVYDYKNFGTADSKALFSDAMAITLYSYHNLDNGFAAGYQHNGFGLGLP
ATLVTALLGGTDSQGVIPGIPWNPDSEKLALDAVKKAGWTPITASQLGYD
GKTDARGTFFGEKAGYTTAQVEILGKYDAQGHLTEIGIAFRGTSGPRENL
ILDSIGDVINDLLAAFGPKDYAKNYVGEAFGNLLNDVVAFAKANGLSGKD
VLVSGHSLGGLAVNSMADLSGGKWGGFFADSNYIAYASPTQSSTDKVLNV
GYENDPVFRALDGSTFTGASVGVHDAPKESATDNIVSFNDHYASTAWNLL
PFSILNIPTWISHLPTAYGDGMNRIIESKFYDLTSKDSTIIVANLSDPAR
ANTWVQDLNRNAETHKGSTFIIGSDSNDLIQGGSGNDYLEGRAGNDTFRD
GGGYNVILGGAGNNTLDLQKSVNTFDFANDGAGNLYVRDANGGISITRDI
GSIVTKEPGFLWGLFKDDVTHSVTASGLKVGSNVTQYDASVKGTNGADTL
KAHAGGDWLFGLDGNDHLIGGVGNDVFVGGAGNDLMESGGGADTFLFNGA
FGQDRVVGFTSNDKLVFLGVQGVLPNDDFRAHASMVGQDTVLKFGGDSVT
LVGVALNSLSADGIVIA


References
3 more
    Title: Crystal structure of a family I.3 lipase from Pseudomonas sp. MIS38 in a closed conformation
    Angkawidjaja C, You DJ, Matsumura H, Kuwahara K, Koga Y, Takano K, Kanaya S
    Ref: FEBS Letters, 581:5060, 2007 : PubMed

            

    Title: Extracellular overproduction and preliminary crystallographic analysis of a family I.3 lipase
    Angkawidjaja C, You DJ, Matsumura H, Koga Y, Takano K, Kanaya S
    Ref: Acta Crystallographica Sect F Struct Biol Cryst Commun, 63:187, 2007 : PubMed

            

    Title: Overproduction in Escherichia coli, purification and characterization of a family I.3 lipase from Pseudomonas sp. MIS38
    Amada K, Haruki M, Imanaka T, Morikawa M, Kanaya S
    Ref: Biochimica & Biophysica Acta, 1478:201, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer