Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: sacd2-q21ll5

Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) Uncharacterized protein

Relationship
Family|NLS3-Tex30
Block| X
Position in NCBI Life Tree|Saccharophagus degradans
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Cellvibrionales: N E > Cellvibrionaceae: N E > Saccharophagus: N E > Saccharophagus degradans: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP000282
1 UniProt : Q21LL5
1 UniProt : Q21LL5
1 Interpro : Q21LL5
1 Pfam : Q21LL5
1 PIRSF : Q21LL5
1 SUPERFAM : Q21LL5
Sequence
Graphical view for this peptide sequence: sacd2-q21ll5
Colored MSA for NLS3-Tex30 (raw)
MIINPLPERFLVNAAQPQAPVLLLAHGAGAPMDSPFMEVLARELVQQGVS
VVRFEFPYMAQRRIGGSKRPAPKADTLIDFFREQIQLVTRHLDCPLFIGG
KSMGGRIGTMTAAQQPVLGALGFGYPFHAPGKPAGNRVDHLADLNVPVQI
IQGTRDPFGKPEDVQTYALAASVNVHWLQTADHDFKPLKASGLTQAQCIT
DAAEQAAQFIKNVNENLS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MIINPLPERFLVNAAQPQAPVLLLAHGAGAPMDSPFMEVLARELVQQGVS
VVRFEFPYMAQRRIGGSKRPAPKADTLIDFFREQIQLVTRHLDCPLFIGG
KSMGGRIGTMTAAQQPVLGALGFGYPFHAPGKPAGNRVDHLADLNVPVQI
IQGTRDPFGKPEDVQTYALAASVNVHWLQTADHDFKPLKASGLTQAQCIT
DAAEQAAQFIKNVNENLS


Reference
    Title: Complete genome sequence of the complex carbohydrate-degrading marine bacterium, Saccharophagus degradans strain 2-40 T
    Weiner RM, Taylor LE, 2nd, Henrissat B, Hauser L, Land M, Coutinho PM, Rancurel C, Saunders EH, Longmire AG and Hutcheson S <9 more author(s)>
    Ref: PLoS Genet, 4:e1000087, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer