Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: spoli-d3gdm1

Spodoptera littoralis (Egyptian cotton leafworm) Antennal esterase CXE10 SlCXE10 SlitCXE10

Relationship
Family|Carb_B_Arthropoda
Block| C
Position in NCBI Life Tree|Spodoptera littoralis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Amphiesmenoptera: N E > Lepidoptera: N E > Glossata: N E > Neolepidoptera: N E > Heteroneura: N E > Ditrysia: N E > Obtectomera: N E > Noctuoidea: N E > Noctuidae: N E > Amphipyrinae: N E > Spodoptera: N E > Spodoptera littoralis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





3 substrates: Prodenialure, Prodlure, Z-3-Hexenyl-acetate
No inhibitor
2 Genbank : FJ652453, ACV60237
1 UniProt : D3GDM1
1 UniProt : D3GDM1
1 Interpro : D3GDM1
1 Prodom : D3GDM1
1 Pfam : D3GDM1
1 PIRSF : D3GDM1
1 SUPERFAM : D3GDM1
Sequence
Graphical view for this peptide sequence: spoli-d3gdm1
Colored MSA for Carb_B_Arthropoda (raw)
MVQVRVSEGVLEGEQVQNEYGGSFYRFRGIPYAQPPLGDLRFKAPQPIKP
WQGVRQAKQFGSVCYQYNPTNLGLSNMSEDCLYVNVYTPDIKPQTPIPVM
VWIHGGGFMWGSGNDDLYGPEFLIRHNVVLVTFNYRLEALGFLCLDTADV
PGNAGMKDQVAALRWVKRNIANFGGNPDNITIFGESAGGGSVSHHLISPM
SKGLFNRAIPQSGSTACFWATAFEPKEKAILLAKQLGFHSEDPKELYEFF
KKQPCENLVKLNLQVTTSQKSYEIHFSIANEKDFGQERFFYGDIVDVIKN
NLQEGVDIMTGYTKDEYTIAVSIGGPLEDILAKAQRYREFFAPKLLHNYG
TITDQLEAARKLQKFYFKNEKVSKDNIDNLLNYMSVDMFVYGVMFAAKLY
SRKNKVYVYKFNCFSERNVLANAFCVGHLTDDRSVVSHADDLAYLFPVKL
FTQKVNKTSVTFKLIDRVTTLWTNFAKYGNPTPDDSLGVKWLPYTLAAQD
YMDIGNTLVPGNSPDKEELDFWESVLHQHLPKFSTLNQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVQVRVSEGVLEGEQVQNEYGGSFYRFRGIPYAQPPLGDLRFKAPQPIKP
WQGVRQAKQFGSVCYQYNPTNLGLSNMSEDCLYVNVYTPDIKPQTPIPVM
VWIHGGGFMWGSGNDDLYGPEFLIRHNVVLVTFNYRLEALGFLCLDTADV
PGNAGMKDQVAALRWVKRNIANFGGNPDNITIFGESAGGGSVSHHLISPM
SKGLFNRAIPQSGSTACFWATAFEPKEKAILLAKQLGFHSEDPKELYEFF
KKQPCENLVKLNLQVTTSQKSYEIHFSIANEKDFGQERFFYGDIVDVIKN
NLQEGVDIMTGYTKDEYTIAVSIGGPLEDILAKAQRYREFFAPKLLHNYG
TITDQLEAARKLQKFYFKNEKVSKDNIDNLLNYMSVDMFVYGVMFAAKLY
SRKNKVYVYKFNCFSERNVLANAFCVGHLTDDRSVVSHADDLAYLFPVKL
FTQKVNKTSVTFKLIDRVTTLWTNFAKYGNPTPDDSLGVKWLPYTLAAQD
YMDIGNTLVPGNSPDKEELDFWESVLHQHLPKFSTLNQ


References
    Title: A diversity of putative carboxylesterases are expressed in the antennae of the noctuid moth Spodoptera littoralis
    Durand N, Carot-Sans G, Chertemps T, Montagne N, Jacquin-Joly E, Debernard S, Maibeche-Coisne M
    Ref: Insect Molecular Biology, 19:87, 2010 : PubMed

            

    Title: Characterization of an antennal carboxylesterase from the pest moth Spodoptera littoralis degrading a host plant odorant
    Durand N, Carot-Sans G, Chertemps T, Bozzolan F, Party V, Renou M, Debernard S, Rosell G, Maibeche-Coisne M
    Ref: PLoS ONE, 5:e15026, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer