Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: spolt-ACHE1

Spodoptera litura (Asian cotton leafworm); Spodoptera frugiperda; Spodoptera exigua (Beet armyworm); Spodoptera littoralis (Egyptian cotton leafworm) acetylcholinesterase 1

Comment
Other strains: Spodoptera litura (Asian cotton leafworm); Spodoptera frugiperda; Spodoptera exigua (Beet armyworm) Spodoptera littoralis (Egyptian cotton leafworm) Spodoptera exigua and Spodoptera litura differ only at


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Spodoptera litura
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Amphiesmenoptera: N E > Lepidoptera: N E > Glossata: N E > Neolepidoptera: N E > Heteroneura: N E > Ditrysia: N E > Obtectomera: N E > Noctuoidea: N E > Noctuidae: N E > Amphipyrinae: N E > Spodoptera: N E > Spodoptera litura: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
5 mutations: Table (e.g. : A201S, F290V, F331Y ... more)
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: spolt-ACHE1
Colored MSA for ACHE (raw)
MRVVLAALTALAARALAGPHEHRARHHAPEHPPHFPAPAPPQPYRGHGEA
VRYNPELDTILPRLEDHETSSKRAKFEDAETSSKRAKYDERFYSNHERAD
EEPMADEPQLGPEDDDPLVVRTRKGRVRGITLTAATGKKVDAWFGIPYAQ
KPVGDLRFRHPRPAESWGDEILNTTTLPHSCVQIIDTVFGDFPGAMMWNP
NTDMQEDCLFINIVTPRPRPKNAAVMLWVFGGGFYSGTATLDVYDAKILV
SEEKVVYVSMQYRVASLGFLFFDTPDVPGNAGLFDQLMALQWVKDNIAYF
GGNPHNITLFGESAGAVSVSLHLLSPLSRNLFSQAIMQSGAATAPWAIIS
REESILRGIRLAEAVHCPHSRTDMGPMIECLRKKSPDELVNNEWGTLGIC
EFPFVPIIDGSFLDELPARSLAHQNFKKTNLLMGSNTEEGYYFILYYLTE
LFPKEENVGISREQYLQAVRELNPYVNDVGRQAIVFEYTDWLNPDDPIRN
RNALDKMVGDYHFTCGVNEMAHRYAETGNNVFTYYYKHRSKNNPWPSWTG
VMHADEINYVFGEPLNPGKNYSPEEVEFSKRLMRYWANFARTGNPSINPN
GESTKIYWPVHSATGREYLSLAVNSSTVGHGLRVKECAFWQKYLPQLMSA
TNKPEPPKNCTSSAAPIKVPYEIIGVGVVIATGLAKTTMFKYIV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRVVLAALTALAARALAGPHEHRARHHAPEHPPHFPAPAPPQPYRGHGEA
VRYNPELDTILPRLEDHETSSKRAKFEDAETSSKRAKYDERFYSNHERAD
EEPMADEPQLGPEDDDPLVVRTRKGRVRGITLTAATGKKVDAWFGIPYAQ
KPVGDLRFRHPRPAESWGDEILNTTTLPHSCVQIIDTVFGDFPGAMMWNP
NTDMQEDCLFINIVTPRPRPKNAAVMLWVFGGGFYSGTATLDVYDAKILV
SEEKVVYVSMQYRVASLGFLFFDTPDVPGNAGLFDQLMALQWVKDNIAYF
GGNPHNITLFGESAGAVSVSLHLLSPLSRNLFSQAIMQSGAATAPWAIIS
REESILRGIRLAEAVHCPHSRTDMGPMIECLRKKSPDELVNNEWGTLGIC
EFPFVPIIDGSFLDELPARSLAHQNFKKTNLLMGSNTEEGYYFILYYLTE
LFPKEENVGISREQYLQAVRELNPYVNDVGRQAIVFEYTDWLNPDDPIRN
RNALDKMVGDYHFTCGVNEMAHRYAETGNNVFTYYYKHRSKNNPWPSWTG
VMHADEINYVFGEPLNPGKNYSPEEVEFSKRLMRYWANFARTGNPSINPN
GESTKIYWPVHSATGREYLSLAVNSSTVGHGLRVKECAFWQKYLPQLMSA
TNKPEPPKNCTSSAAPIKVPYEIIGVGVVIATGLAKTTMFKYIV


References
    Title: Associations between acetylcholinesterase-1 mutations and chlorpyrifos resistance in beet armyworm, Spodoptera exigua
    Teng H, Zuo Y, Jin Z, Wu Y, Yang Y
    Ref: Pestic Biochem Physiol, 184:105105, 2022 : PubMed

            

    Title: Molecular and functional properties of two Spodoptera exigua acetylcholinesterase genes
    Zhao J, Hao D, Xiao L, Tan Y, Jiang Y, Bai L, Wang K
    Ref: Archives of Insect Biochemistry & Physiology, :e21554, 2019 : PubMed

            

    Title: Cloning, expression, and functional analysis of two acetylcholinesterase genes in Spodoptera litura (Lepidoptera: Noctuidae)
    Salim AM, Shakeel M, Ji J, Kang T, Zhang Y, Ali E, Xiao Z, Lu Y, Wan H, Li J
    Ref: Comparative Biochemistry & Physiology B Biochem Mol Biol, 206:16, 2017 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer