Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: strhy-ORFZ

Streptomyces hygroscopicus orfz protein

Relationship
Family|Duf_1100-S
Block| X
Position in NCBI Life Tree|Streptomyces hygroscopicus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces hygroscopicus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : X86780
1 UniProt : Q54287
1 Interpro : Q54287
1 Prodom : Q54287
1 Pfam : Q54287
1 PIRSF : Q54287
1 SUPERFAM : Q54287
Sequence
Graphical view for this peptide sequence: strhy-ORFZ
Colored MSA for Duf_1100-S (raw)
MKFLYDDESFSFEALRAAGYAAYGGADLGEVLVTCRQIPEGDEEAWSAQW
AATAARIERIGRDALAAGHRVSAREALLRASNYYRTADFYRRENPAADAE
SARLAKASQQTFADAAPLLDTPARALRIPYEDTTLPGYLFLVDDSGTPRP
TVLFHGGYDSTLEEDYLALAAGALRRGYNVIAFDGPGQGSTVREQGLHFP
PDWEAVVTPVVDFALTLPEVDAEQLVLMGMSLGGYLAARAAAFEHRVAAC
VLYDGVYDFHAVIAATAGRAASTPGGMEALMAQNTMVRWVVRNGRWTFGV
SGVDELVRAAEPYTMAGIADRITCPTLVLEAENDQFFKGQPQRLFDELTC
QKELISFREDEGAGEHCHEGAMFLFHQRTFDWLDTVLAG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKFLYDDESFSFEALRAAGYAAYGGADLGEVLVTCRQIPEGDEEAWSAQW
AATAARIERIGRDALAAGHRVSAREALLRASNYYRTADFYRRENPAADAE
SARLAKASQQTFADAAPLLDTPARALRIPYEDTTLPGYLFLVDDSGTPRP
TVLFHGGYDSTLEEDYLALAAGALRRGYNVIAFDGPGQGSTVREQGLHFP
PDWEAVVTPVVDFALTLPEVDAEQLVLMGMSLGGYLAARAAAFEHRVAAC
VLYDGVYDFHAVIAATAGRAASTPGGMEALMAQNTMVRWVVRNGRWTFGV
SGVDELVRAAEPYTMAGIADRITCPTLVLEAENDQFFKGQPQRLFDELTC
QKELISFREDEGAGEHCHEGAMFLFHQRTFDWLDTVLAG


References
    Title: Organization of the biosynthetic gene cluster for rapamycin in Streptomyces hygroscopicus: analysis of the enzymatic domains in the modular polyketide synthase
    Aparicio JF, Molnar I, Schwecke T, Konig A, Haydock SF, Khaw LE, Staunton J, Leadlay PF
    Ref: Gene, 169:9, 1996 : PubMed

            

    Title: Organisation of the biosynthetic gene cluster for rapamycin in Streptomyces hygroscopicus: analysis of genes flanking the polyketide synthase
    Molnar I, Aparicio JF, Haydock SF, Khaw LE, Schwecke T, Konig A, Staunton J, Leadlay PF
    Ref: Gene, 169:1, 1996 : PubMed

            

    Title: The biosynthetic gene cluster for the polyketide immunosuppressant rapamycin
    Schwecke T, Aparicio JF, Molnar I, Konig A, Khaw LE, Haydock SF, Oliynyk M, Caffrey P, Cortes J and et al. <1 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 92:7839, 1995 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer