Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: strpu-rdmC

Streptomyces purpurascens ATCC 25489 RdmC (rdmC)

Comment
rdmc protein possible C-C hydrolase


Relationship
Family|Aclacinomycin-methylesterase_RdmC
Block| X
Position in NCBI Life Tree|Streptomyces purpurascens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces purpurascens: N E


Molecular evidence
Database
No mutation
2 structures: 1Q0R, 1Q0Z
No kinetic





1 substrate:
Aclacinomycin
No inhibitor
1 Genbank : U10405
1 Ncbi-nid : 505668
1 Ncbi-pid : 505671
2 Structure : 1Q0R, 1Q0Z
1 UniProt : Q54528
1 Interpro : Q54528
1 Prodom : Q54528
1 Pfam : Q54528
1 PIRSF : Q54528
1 SUPERFAM : Q54528
Sequence
Graphical view for this peptide sequence: strpu-rdmC
Colored MSA for Aclacinomycin-methylesterase_RdmC (raw)
MSERIVPSGDVELWSDDFGDPADPALLLVMGGNLSALGWPDEFARRLADG
GLHVIRYDHRDTGRSTTRDFAAHPYGFGELAADAVAVLDGWGVDRAHVVG
LSMGATITQVIALDHHDRLSSLTMLLGGGLDIDFDANIERVMRGEPTLDG
LPGPQQPFLDALALMNQPAEGRAAEVAKRVSKWRILSGTGVPFDDAEYAR
WEERAIDHAGGVLAEPYAHYSLTLPPPSRAAELREVTVPTLVIQAEHDPI
APAPHGKHLAGLIPTARLAEIPGMGHALPSSVHGPLAEVILAHTRSAA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSERIVPSGDVELWSDDFGDPADPALLLVMGGNLSALGWPDEFARRLADG
GLHVIRYDHRDTGRSTTRDFAAHPYGFGELAADAVAVLDGWGVDRAHVVG
LSMGATITQVIALDHHDRLSSLTMLLGGGLDIDFDANIERVMRGEPTLDG
LPGPQQPFLDALALMNQPAEGRAAEVAKRVSKWRILSGTGVPFDDAEYAR
WEERAIDHAGGVLAEPYAHYSLTLPPPSRAAELREVTVPTLVIQAEHDPI
APAPHGKHLAGLIPTARLAEIPGMGHALPSSVHGPLAEVILAHTRSAA


References
    Title: Crystal structure of aclacinomycin methylesterase with bound product analogues: implications for anthracycline recognition and mechanism
    Jansson A, Niemi J, Mantsala P, Schneider G
    Ref: Journal of Biological Chemistry, 278:39006, 2003 : PubMed

            

    Title: Nucleotide sequences and expression of genes from Streptomyces purpurascens that cause the production of new anthracyclines in Streptomyces galilaeus
    Niemi J, Mantsala P
    Ref: Journal of Bacteriology, 177:2942, 1995 : PubMed

            

    Title: Hybrid anthracycline antibiotics: production of new anthracyclines by cloned genes from Streptomyces purpurascens in Streptomyces galilaeus
    Niemi J, Ylihonko K, Hakala J, Parssinen R, Kopio A, Mantsala P
    Ref: Microbiology, 140:1351, 1994 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer