Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: vibvy-y856

Vibrio vulnificus hypothetical FrsA upf0255 protein vv0856

Comment
Other strains: Vibrio vulnificus (strains YJ016; MO6-24/O) The fermentation/respiration switch protein FrsA (product of the yafA gene in E. Coli) binds the dephosphorylated form of glucose-specific enzyme IIAGl the interaction increases the glucose fermentation under oxygen-limited conditions. FrsA is a pyruvate decarboxylase (see ecoli-yafa)


Relationship
Family|Duf_1100-R
Block| X
Position in NCBI Life Tree|Vibrio vulnificus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Vibrionales: N E > Vibrionaceae: N E > Vibrio: N E > Vibrio vulnificus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
3 structures: 3MVE, 3OUR, 4I4C
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: AE016798, BA000037, CP002469
3 UniProt : Q7MN61, Q8DF91, D9IR22
3 Structure : 3MVE, 3OUR, 4I4C
3 UniProt : Q7MN61, Q8DF91, D9IR22
3 Interpro : Q7MN61, Q8DF91, D9IR22
3 Prodom : Q7MN61, Q8DF91, D9IR22
3 Pfam : Q7MN61, Q8DF91, D9IR22
3 PIRSF : Q7MN61, Q8DF91, D9IR22
3 SUPERFAM : Q7MN61, Q8DF91, D9IR22
Sequence
Graphical view for this peptide sequence: vibvy-y856
Colored MSA for Duf_1100-R (raw)
MSEEVSKNLSETLFVKHKQAKETSALTQYMPTSQSLLDEIKEKNGFSWYR
NLRRLQWVWQGVDPIEQEQVLARIASSKHSRTDEQWLDTVMGYHSGNWAY
EWTRLGMEHQKRAGEMTNEAASEALFSASLCYSIAGYPHLKSDNLAIQAQ
VLANSAYLEAAKKSKYIIKQLEIPFEKGKITAHLHLTNTDKPHPVVIVSA
GLDSLQTDMWRLFRDHLAKHDIAMLTVDMPSVGYSSKYPLTEDYSRLHQA
VLNELFSIPYVDHHRVGLIGFRFGGNAMVRLSFLEQEKIKACVILGAPIH
DIFASPQKLQQMPKMYLDVLASRLGKSVVDIYSLSGQMAAWSLKVQGFLS
SRKTKVPILAMSLEGDPVSPYSDNQMVAFFSTYGKAKKISSKTITQGYEQ
SLDLAIKWLEDELLR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSEEVSKNLSETLFVKHKQAKETSALTQYMPTSQSLLDEIKEKNGFSWYR
NLRRLQWVWQGVDPIEQEQVLARIASSKHSRTDEQWLDTVMGYHSGNWAY
EWTRLGMEHQKRAGEMTNEAASEALFSASLCYSIAGYPHLKSDNLAIQAQ
VLANSAYLEAAKKSKYIIKQLEIPFEKGKITAHLHLTNTDKPHPVVIVSA
GLDSLQTDMWRLFRDHLAKHDIAMLTVDMPSVGYSSKYPLTEDYSRLHQA
VLNELFSIPYVDHHRVGLIGFRFGGNAMVRLSFLEQEKIKACVILGAPIH
DIFASPQKLQQMPKMYLDVLASRLGKSVVDIYSLSGQMAAWSLKVQGFLS
SRKTKVPILAMSLEGDPVSPYSDNQMVAFFSTYGKAKKISSKTITQGYEQ
SLDLAIKWLEDELLR


References
3 more
    Title: Computational, structural, and kinetic evidence that Vibrio vulnificus FrsA is not a cofactor-independent pyruvate decarboxylase
    Kellett WF, Brunk E, Desai BJ, Fedorov AA, Almo SC, Gerlt JA, Rothlisberger U, Richards NG
    Ref: Biochemistry, 52:1842, 2013 : PubMed

            

    Title: FrsA functions as a cofactor-independent decarboxylase to control metabolic flux
    Lee KJ, Jeong CS, An YJ, Lee HJ, Park SJ, Seok YJ, Kim P, Lee JH, Lee KH, Cha SS
    Ref: Nat Chemical Biology, 7:434, 2011 : PubMed

            

    Title: A novel fermentation/respiration switch protein regulated by enzyme IIAGlc in Escherichia coli
    Koo BM, Yoon MJ, Lee CR, Nam TW, Choe YJ, Jaffe H, Peterkofsky A, Seok YJ
    Ref: Journal of Biological Chemistry, 279:31613, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer