Type : Fasciculin2 variant, Peptide, Natural_modified
Chemical_Nomenclature : TMCYSHTTTSRAILTNCGENSCYRLSRRHPPKMVLGRGCGCPPGDDNLEVKCCTSPDKCNY
Canonical SMILES :
InChI :
InChIKey :
Other name(s) :
MW : 7 kD
Formula :
CAS_number :
PubChem :
UniChem :
Families : K25L-fasciculin2 ligand of proteins in family
ACHE
Title : Expression and activity of mutants of fasciculin, a peptidic acetylcholinesterase inhibitor from mamba venom - Marchot_1997_J.Biol.Chem_272_3502 |
Author(s) : Marchot P , Prowse CN , Kanter J , Camp S , Ackermann EJ , Radic Z , Bougis PE , Taylor P |
Ref : Journal of Biological Chemistry , 272 :3502 , 1997 |
Abstract : |
PubMedSearch : Marchot_1997_J.Biol.Chem_272_3502 |
PubMedID: 9013597 |