T8A,T9A-fasciculin2

General

Type : Fasciculin2 variant, Natural_modified, Peptide

Chemical_Nomenclature : TMCYSHTAASRAILTNCGENSCYRKSRRHPPKMVLGRGCGCPPGDDNLEVKCCTSPDKCNY

Canonical SMILES :

InChI :

InChIKey :

Other name(s) :


MW : 7 kD

Formula :

CAS_number :

PubChem :

UniChem :

Target

Families : T8A,T9A-fasciculin2 ligand of proteins in family
ACHE

References (3)

Title : Expression and activity of mutants of fasciculin, a peptidic acetylcholinesterase inhibitor from mamba venom - Marchot_1997_J.Biol.Chem_272_3502
Author(s) : Marchot P , Prowse CN , Kanter J , Camp S , Ackermann EJ , Radic Z , Bougis PE , Taylor P
Ref : Journal of Biological Chemistry , 272 :3502 , 1997
Abstract :
PubMedSearch : Marchot_1997_J.Biol.Chem_272_3502
PubMedID: 9013597

Title : Expression and activity of mutants of fasciculin, a peptidic acetylcholinesterase inhibitor from mamba venom - Marchot_1997_J.Biol.Chem_272_3502
Author(s) : Marchot P , Prowse CN , Kanter J , Camp S , Ackermann EJ , Radic Z , Bougis PE , Taylor P
Ref : Journal of Biological Chemistry , 272 :3502 , 1997
Abstract :
PubMedSearch : Marchot_1997_J.Biol.Chem_272_3502
PubMedID: 9013597

Title : Expression and activity of mutants of fasciculin, a peptidic acetylcholinesterase inhibitor from mamba venom - Marchot_1997_J.Biol.Chem_272_3502
Author(s) : Marchot P , Prowse CN , Kanter J , Camp S , Ackermann EJ , Radic Z , Bougis PE , Taylor P
Ref : Journal of Biological Chemistry , 272 :3502 , 1997
Abstract :
PubMedSearch : Marchot_1997_J.Biol.Chem_272_3502
PubMedID: 9013597