9bact-Q0GMU2

Uncultured bacterium clone pUE5 esterase/lipase (estE5)

Comment

Relationship

Family : Hormone-sensitive_lipase_like

Block : H

Position in NCBI Life Tree : uncultured bacterium

Molecular evidence

No mutation

No kinetic

No disease

Database

Sequence

Peptide

MAGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKA
ADDIQVEQVT VAGCAAEWVRAPGCQAGKAILYLHGGGYV
MGSINTHRSMVGEISRASQAA ALLLDYRLAPEHPFPAAV
EDGVAAYRWLLDQGFKPQHLSISGDSAGGGLV LAVLVSA
RDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMVAPG
GIN KMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGR
DEVLLDDSIKLDAK AKADGVKSTLEIWDDMIHVWHAFHP
MLPEGKQAIVRVGEFMREQWAA

References

Title : Structural and functional analysis of a novel EstE5 belonging to the subfamily of hormone-sensitive lipase - Nam_2009_Biochem.Biophys.Res.Commun_379_553
Author(s) : Nam KH , Kim MY , Kim SJ , Priyadarshi A , Lee WH , Hwang KY
Ref : Biochemical & Biophysical Research Communications , 379 :553 , 2009
Abstract : Nam_2009_Biochem.Biophys.Res.Commun_379_553
ESTHER : Nam_2009_Biochem.Biophys.Res.Commun_379_553
PubMedSearch : Nam_2009_Biochem.Biophys.Res.Commun_379_553
PubMedID: 19116143
Gene_locus related to this paper: 9bact-Q0GMU2

Title : The crystal structure of an HSL-homolog EstE5 complex with PMSF reveals a unique configuration that inhibits the nucleophile Ser144 in catalytic triads - Nam_2009_Biochem.Biophys.Res.Commun_389_247
Author(s) : Nam KH , Kim SJ , Priyadarshi A , Kim HS , Hwang KY
Ref : Biochemical & Biophysical Research Communications , 389 :247 , 2009
Abstract : Nam_2009_Biochem.Biophys.Res.Commun_389_247
ESTHER : Nam_2009_Biochem.Biophys.Res.Commun_389_247
PubMedSearch : Nam_2009_Biochem.Biophys.Res.Commun_389_247
PubMedID: 19715665
Gene_locus related to this paper: 9bact-Q0GMU2