9magn-a0a200rdw7

Macleaya cordata. Alpha/beta hydrolase fold-3

Comment

Relationship

Family : Plant_carboxylesterase

Block : H

Position in NCBI Life Tree : Macleaya cordata

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MKKNKKVVDQVSCWLKIFDDGSVDRTWMGPPEFEFMAKPV
PPHEDFIDGV ATRDVTMDNISGLSARIYLPERKSGDGSK
LPVLLHFHGGGFCISQADWYM YYQAYTQLVRSAQAVCVS
VKLRLAPEHRLPAACDDGYSTLLWLRSVARAE AIEPWLE
AHADFSRVFLIGDSSGGNIVHEVAARAGKEKWDPLSLAGG
VLL HPGFVRAERSKSELETQNESPFLTLEMVDKFLALAL
PLGSTKDHPITCPM GSMAPPLDGLNLPPFLMAVAELDLI
RDTELEYIEAMKKAGKDVEVFHSEG VGHSFYLKKVPVEM
DPQNAAQTDLLIAGITDFIKRH

References

Title : The Genome of Medicinal Plant Macleaya cordata Provides New Insights into Benzylisoquinoline Alkaloids Metabolism - Liu_2017_Mol.Plant_10_975
Author(s) : Liu X , Liu Y , Huang P , Ma Y , Qing Z , Tang Q , Cao H , Cheng P , Zheng Y , Yuan Z , Zhou Y , Liu J , Tang Z , Zhuo Y , Zhang Y , Yu L , Huang J , Yang P , Peng Q , Zhang J , Jiang W , Zhang Z , Lin K , Ro DK , Chen X , Xiong X , Shang Y , Huang S , Zeng J
Ref : Mol Plant , 10 :975 , 2017
Abstract : Liu_2017_Mol.Plant_10_975
ESTHER : Liu_2017_Mol.Plant_10_975
PubMedSearch : Liu_2017_Mol.Plant_10_975
PubMedID: 28552780
Gene_locus related to this paper: 9magn-a0a200rdw7 , 9magn-a0a200qd12 , 9magn-a0a200pqd0 , 9magn-a0a200q3h1 , 9magn-a0a200r223 , 9magn-a0a200qv20