9magn-a0a200qv20

Macleaya cordata. Lipase

Comment

Relationship

Family : Plant_lipase_EDS1-like

Block : L

Position in NCBI Life Tree : Macleaya cordata

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MERRSVSESVGMSDVITTKACSLAKAARTSSSFFLVKNPN
SSSAIFAFPG SWSIDHWYSQSSFGASKIDTTLFPSLRSI
GNNETAIVNGSFLQQFTEILR ISKLREKVNKAVGENKQI
VFTGHSSGGAIAVLATIWQLEQLRKQKSHNQI TPLCVTF
GSPLVGDRVFGHALRREDWSRHFVHFIMKDDIVPRILLAP
LSS IQRELQAILPFFDPKVKNSRRESMGRSSEALGIFKT
VLKNTLSVTSHAAC LLKGCTNLLFEAVSNFIELSPYRPF
GTYIFCAGNGKLFTVKNPDAILQLL FHCLQLNPEQEVTE
MAYRCLQEHLVYENQLRESMQMQDVVYLDELSLSSE AAD
SDERRLMEIAMNDLGLSTKARICLHAAGEFEKKKLRNQGK
IDANISK IEEALKFVHGYREKCEVSEMGYYDAFKLQREV
TDFEANIKRLELAGIWDE IIEMLKRYELPDGFENRKEWV
ELGTKFRRLVEPLDIANYYRHSKGNNLRT YMMIGGRPKR
YRYTQRWLEHADQVKTGSWSESCFLAEVEELCILAGKGKA
FEEMEEKVLEIEREVQRWVTCRVLQRDVFLEETTFVKWW
RTLPKQHKSRS CIARLMNGEGKNLPPIN

References

Title : The Genome of Medicinal Plant Macleaya cordata Provides New Insights into Benzylisoquinoline Alkaloids Metabolism - Liu_2017_Mol.Plant_10_975
Author(s) : Liu X , Liu Y , Huang P , Ma Y , Qing Z , Tang Q , Cao H , Cheng P , Zheng Y , Yuan Z , Zhou Y , Liu J , Tang Z , Zhuo Y , Zhang Y , Yu L , Huang J , Yang P , Peng Q , Zhang J , Jiang W , Zhang Z , Lin K , Ro DK , Chen X , Xiong X , Shang Y , Huang S , Zeng J
Ref : Mol Plant , 10 :975 , 2017
Abstract : Liu_2017_Mol.Plant_10_975
ESTHER : Liu_2017_Mol.Plant_10_975
PubMedSearch : Liu_2017_Mol.Plant_10_975
PubMedID: 28552780
Gene_locus related to this paper: 9magn-a0a200rdw7 , 9magn-a0a200qd12 , 9magn-a0a200pqd0 , 9magn-a0a200q3h1 , 9magn-a0a200r223 , 9magn-a0a200qv20