9magn-a0a200r223

Macleaya cordata. Peptidase S9

Comment

Relationship

Family : Glutamyl_Peptidase_S9

Block : X

Position in NCBI Life Tree : Macleaya cordata

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MTISSFHNPVPVNAIAAEDGGSGSNGSVSSTPTDYEESSS
LDGGYRIPPP EIRDIVDAPPLPALSFSPQRDKILFLKRR
ALPPLTELARPEEKLAGVRID GKCNTRSRMSFYTGIGIH
QLMQDGTLGPEKEVHGFPDGAKINFVSWSHDG RHLSFSI
RFDEEQSENSKLRVWVADVETGEARPLFQSPDIYLNAVFD
NYV WVNDSTLLICTIPSSRGDPPKKPLVPSGPKIQSNEQ
KNVVQVRTFQDLLK DEYDEDLFDYYATSQLLLASLDGTV
KAIGPPAVYTSLDPSPDEKYLLISS IHRPYSFIVPCGRF
PKKVDIWTTDGKFVRELCDLPLAEDIPIAFNSVRKG RRS
INWRADKPSTLYWVETQDGGDAKVEVSPRDIVYTQPADAL
DGEQAEV LHKLDLRYGGISWCDDSLALVYESWYKTRRTR
TWVISPGSKDVSPRILFD RSSEDVYSDPGSPMLRRTPAG
TYVIAKIKKEKDAEPCILLNGSGATPEGN IPFLDLFDIN
TGSKERIWESNKEKYYETVVALMSDQNEGDLYLDQLKILT
SKESKTENTQYYLQSWPDKKVCQITNFPHPYPQLASLQK
EMIRYQRKDGV QLTATLYLPPGYDPSKDGPLPCLVWSYP
GEFKSKDAAGQVRGSPNEFAGI GPTSALLWLARRFAILS
GPTIPIIGEGDEEANDRYVEQLVASAEAAVEEV IRRGVA
HPNKIAVGGHSYGAFMTANLLAHAPHLFCCGVARSGAYNR
TLTP FGFQNEDRTLWEATSTYVEMSPFMSANKIKKPILL
IHGEEDNNSGTLTMQ SDRFFNALKGHGALCRLVVLPFES
HGYAARESIMHVLWETDRWLQKYCVN TPDVVADLDASKD
DPNKTAKDSESKVVSASGGGSPEQDGFHSATRSLLW

References

Title : The Genome of Medicinal Plant Macleaya cordata Provides New Insights into Benzylisoquinoline Alkaloids Metabolism - Liu_2017_Mol.Plant_10_975
Author(s) : Liu X , Liu Y , Huang P , Ma Y , Qing Z , Tang Q , Cao H , Cheng P , Zheng Y , Yuan Z , Zhou Y , Liu J , Tang Z , Zhuo Y , Zhang Y , Yu L , Huang J , Yang P , Peng Q , Zhang J , Jiang W , Zhang Z , Lin K , Ro DK , Chen X , Xiong X , Shang Y , Huang S , Zeng J
Ref : Mol Plant , 10 :975 , 2017
Abstract : Liu_2017_Mol.Plant_10_975
ESTHER : Liu_2017_Mol.Plant_10_975
PubMedSearch : Liu_2017_Mol.Plant_10_975
PubMedID: 28552780
Gene_locus related to this paper: 9magn-a0a200rdw7 , 9magn-a0a200qd12 , 9magn-a0a200pqd0 , 9magn-a0a200q3h1 , 9magn-a0a200r223 , 9magn-a0a200qv20