Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: phano-phmG

Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) (Glume blotch fungus) (Parastagonospora nodorum) Hydrolase phmG

Comment
Hydrolyase; part of the gene cluster that mediates the biosynthesis of the mycotoxins phomacins, leucine-derived cytochalasans with potent actin polymerization-inhibitory activities and monocot-specific antigerminative activities


Relationship
Family|Duf_1100-S
Block| X
Position in NCBI Life Tree|Parastagonospora nodorum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > dothideomyceta: N E > Dothideomycetes: N E > Pleosporomycetidae: N E > Pleosporales: N E > Pleosporineae: N E > Phaeosphaeriaceae: N E > Parastagonospora: N E > Parastagonospora nodorum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : EAT91808, XP_001791003
1 UniProt : Q0V6Q1
1 UniProt : Q0V6Q1
1 Interpro : Q0V6Q1
1 Pfam : Q0V6Q1
1 PIRSF : Q0V6Q1
1 SUPERFAM : Q0V6Q1
Sequence
Graphical view for this peptide sequence: phano-phmG
Colored MSA for Duf_1100-S (raw)
MTNSSPPFSTIHQFFPGNTFLNFESVRILSTAPYGGCDAAEFLTAIAAIN
PKDPQTWADAWSHMAHLAETMAEEALSRGDVVAARDGFLRASSYTRASGY
LYINGPTLDEHHPLAFEISKKVQSLFRRALPFLDCDVHVVEIPYVVDSPE
RKEVMLPGYLYLPNAQHRLPDGKIPVLLNTGGADSVQEELYYIHPQGGHT
RGYAVLTFEGPGQGIVLREHGLHMRPDWEVTGWKGYSSTLKREVGVELDL
DRIAVAGASMGGYYALRAAKDSRIKACVAIDPFYDMWDFGTKHISGLFMS
AWTGGWIGDDWVDRIIRLGMRTNFQLRWEVGVTAAFWGIASPAKILKEMS
KYSLKGGYLEKVQCPVLVTGAGKSLYFDTEEHTMKVFDDLGHLEERWRRV
WMPNRPEEGGLQAKIGAFGLANMKAYGFLDEVFGIRRVTVES
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTNSSPPFSTIHQFFPGNTFLNFESVRILSTAPYGGCDAAEFLTAIAAIN
PKDPQTWADAWSHMAHLAETMAEEALSRGDVVAARDGFLRASSYTRASGY
LYINGPTLDEHHPLAFEISKKVQSLFRRALPFLDCDVHVVEIPYVVDSPE
RKEVMLPGYLYLPNAQHRLPDGKIPVLLNTGGADSVQEELYYIHPQGGHT
RGYAVLTFEGPGQGIVLREHGLHMRPDWEVTGWKGYSSTLKREVGVELDL
DRIAVAGASMGGYYALRAAKDSRIKACVAIDPFYDMWDFGTKHISGLFMS
AWTGGWIGDDWVDRIIRLGMRTNFQLRWEVGVTAAFWGIASPAKILKEMS
KYSLKGGYLEKVQCPVLVTGAGKSLYFDTEEHTMKVFDDLGHLEERWRRV
WMPNRPEEGGLQAKIGAFGLANMKAYGFLDEVFGIRRVTVES


References
1 more
    Title: Chemical and Genetic Studies on the Formation of Pyrrolones During the Biosynthesis of Cytochalasans
    Zhang H, Hantke V, Bruhnke P, Skellam E, Cox RJ
    Ref: Chemistry, 10:3106, 2021 : PubMed

            

    Title: Genomics-Driven Discovery of Phytotoxic Cytochalasans Involved in the Virulence of the Wheat Pathogen Parastagonospora nodorum
    Li H, Wei H, Hu J, Lacey E, Sobolev AN, Stubbs KA, Solomon PS, Chooi YH
    Ref: ACS Chemical Biology, 15:226, 2020 : PubMed

            

    Title: Investigating the Function of Cryptic Cytochalasan Cytochrome P450 Monooxygenases Using Combinatorial Biosynthesis
    Wang C, Becker K, Pfutze S, Kuhnert E, Stadler M, Cox RJ, Skellam E
    Ref: Org Lett, 21:8756, 2019 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer