bacc1-q73c56

Bacillus cereus (strain ATCC 10987 and strain G9241) Bacillus thuringiensis serovar israelensis ATCC 35646 hypothetical protein

Comment

Relationship

Family : YcjY-like

Block : X

Position in NCBI Life Tree : Bacillus cereus

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MAVTKKNVRFYARGLQVAGILNIPEGAEEKKQNAAIVCVH
PGSSCKDQTA GLYAEKLAEQGYVTLAFDASYQGESEGAP
RYIEEPAARVEDIRSAVDYVT TLPYIDEERIGVLGVCAG
GGYAVNAAMTERRIKAVGTVVGANIGRLNRES NPIGVLE
AIGKQRTAEARGAEEMITNWIPKNQEELAAAGMTDIDIVE
AVE YYTTPRGQSVNSPNKLNFTSMGSVIGFDAFHLADTL
LTQPLQIIVGSKQG AFGSYKDGYELYEKAASEKKDLLVV
EGASHYDLYDQPEPVKIAVEKLTSF YNENL

References