cupnh-q0kci6

Ralstonia eutropha (strain ATCC 17699 / H16 / DSM 428 / Stanier 337 predicted hydrolase or acyltransferase (EC 3.-.-.-)

Comment

Relationship

Family : 6_AlphaBeta_hydrolase

Block : X

Position in NCBI Life Tree : Ralstonia eutropha

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MTIVLTVFAVLIGLILALGASLYLYTWRTARRIEAAMPPH
GRFVDVPGAR LHVVERGQGPAVLLVHGLSGQLENFGYGM
IGPLAEHFRVIAVDRPGAGHS IRKPGSAADLPAQAAALA
ALCDKLGLERPLVVGHSLGGAIALALAIHHPE RVGGLAL
IAPLTHPPKAISPVFQAMTVPSAWLRRLMAWTLVVPMSIR
RRE AVMDIVFGPDPVPDDFPTRGGGLLALRPRHFLAASE
DLIGAAQSLPALLH RYGTLRVPVSVLYGREDRILDFAEH
GEALAAKVPGATLTLVSGGHMLPVT AIDTSVDFVRDAAA
RLQVPAPAQAQVA