cupnh-q0k9j6

Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) (Ralstonia eutropha) Predicted hydrolase or acyltransferase

Comment

Relationship

Family : Epoxide_hydrolase

Block : X

Position in NCBI Life Tree : Cupriavidus necator

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MNAPQSLPPQVFPRQCFIHAGDVRLCATSWGEPGPGRPTI
VLVHGYPDSS EVWHDVAAQLAGRFHVVAYDVRGAGRSTA
PRATDAYRLQKLADDFIAVID AVSPQRPVHLVGHDWGSI
QSWEFVTDARLQGRIASFTSCSGPCLDHAAIG LRELRGQ
RSLAALGKTLRQLAASWYIGAFHLPWLPELTWRLWLGRAW
PRY LRLTEGLRTGPSPTQTADGCHGVRLYRANFVPVLRA
PRHCHAHAPVQVIV PLHDRYVKPALTEDVHRWTTQLWRR
TVPAHHWLPLADAQGFAIMVREFVE HMEGEPASPALLAA
RLR