cupnh-q0kdv2

Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) (Ralstonia eutropha) Putative uncharacterized protein h16_A0671

Comment

Relationship

Family : Duf_3141

Block : X

Position in NCBI Life Tree : Cupriavidus necator

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MTARERADLPRDSSATSTATSLSAHANPFAALAQPALEYA
LDAWQRTVLL LDILRQRGNESAEHELEGMPPVLVFEHEL
LADGRQLPEPANYALLRIVPP ADSPTDPALRPFVVIDPR
AGHGPGIGGFKADSEIGIALRTGHPCYFITFF YEPCPGQ
TIESVARAEAAFLQIVGERHPDAPGKPFIIGNCQAGWALM
MLA AVAPERTGPLLLAGAPLAYWSGVRGRNPMRYSGGLL
GGSWLASLIADLGN GRFDGAWLVENFEQLNPANTLWEKL
YDVYAKADTEGPRFLDFERWWGGHF LMNRAEIDWIVQKL
FVGNRLTAGEVRSTDGKTVVDLRNVRSPVIIFASWG DNI
TPPQQALNWIPDLYASDEELVANDQVIVYCLHPTVGHLGI
FVSAGVA NREHSELFCALDLIDVLPPGLYEAKIEDVAPD
LRHRDLVEGRYLMRFERR GIADILALDDGRDDERAFEVV
RRVAEVNQHIYDTFASPWVRAMSNELSAQ WLRALRPARL
ERELATDVNPWMAWIGALAPLVREHRAPVSADNPLLTLEH
AASAQIVSALDQFRDLRDAWYERAFEAIYASPAMAALVG
LRAPAPVNLES PVTVALRKELAARRLHDAEAAIGQGGTL
EAFVRVLAYVADRPSAIEERPF NLLRRIAREQQQATGQS
GGQADLAAFKTAVRQQSFIVRLDPQRAIRALPA LVPDRE
TRRKLMVAAHRVMTVGGPLSGERLGRYREVAEVMGTGHPR
EVAD SAKGDEAAHQD