ralpi-u3qr80

Ralstonia pickettii; Cupriavidus necator (Ralstonia eutropha); Ralstonia sp. carboxylesterase type b (EC 3.1.1.-)

Comment

"Other strains: Ralstonia pickettii DTP0602\; Cupriavidus necator (strain ATCC 17699 \/ H16 \/ DSM 428 \/ Stanier 337) (Ralstonia eutropha)Ralstonia sp. GA3-3 . Only Ralstonia pickettii seems complete"

Relationship

Family : Carb_B_Bacteria

Block : C

Position in NCBI Life Tree : Ralstonia pickettii DTP0602

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MTIHYPSANLSGEPAMYPIVETRLGKVRGLRCDGVYAFKG
IPYAALPFGM NRLRLPQSAAPWRGVRDALSFGPKSPQIA
YPPGIAKALGELVGGGEDCLT LNIWAPEPGAPGRPVLVW
IPGGMFEFHATGATSIYDGRRFARDGVVCVTI NYRVGAE
GFLYLGDGLANLGLLDQIAALEWVQQNIDAFGGDPGQVTI
FGQ SAGGMSVATLLTVPRAQGLFRRAIVESGNTPHVTSA
ATAKRIGHRLAALL KVDPTREAIASTTPEQVLQAQAQLR
EELTADPDPAFWGEVALSNLPWAPT VDGAILPAPPIDAI
RAGAAANTALLVGSNTEETRLFLVPSGAIDRITEAS LLA
LVAAYGLSAEGLSGYRAAHPTATAGDLFSEIQTDWYWRIP
TVRLADA HAANARVSTYMYEFAWRSPQLGGRLGAAHGVE
IPFIFDNLGPGAEALVGP TPPQSLADAMHRAWVAFAVNG
DCGWPIYDPVHRSTMRFDTPSAVVEDPLA VRLALWHGAP

References

Title : Draft Genome Sequence of Ralstonia sp. Strain GA3-3, Isolated from Australian Suburban Soil - Pearce_2013_Genome.Announc_1_e00414
Author(s) : Pearce SL , Pushiri H , Oakeshott JG , Russell RJ , Pandey G
Ref : Genome Announc , 1 : , 2013
Abstract : Pearce_2013_Genome.Announc_1_e00414
ESTHER : Pearce_2013_Genome.Announc_1_e00414
PubMedSearch : Pearce_2013_Genome.Announc_1_e00414
PubMedID: 23833131
Gene_locus related to this paper: alceu-catD1 , alceu-catD2 , cupnh-q0jyv4 , cupnh-q0k320 , cupnh-q0kd51 , ralpi-u3qr80 , cupnn-g0ewh7