macfa-g7pbk1

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). Hepatic triacylglycerol lipase

Comment

Relationship

Family : Hepatic_Lipase

Block : L

Position in NCBI Life Tree : Macaca fascicularis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Sequence

Peptide

MDISPQCFSILLVLCIFIQSSAHGQSLKPEPFGRRAQAVE
TNKTLHETKT RFLLFGETNQGCQIRINHLDTLQECGFNS
SRPLVMIIHGWSVDGLLENWI WQMVAALKSQPAQPVNVG
LVDWITLAHHHYTIAVRNTRLVGKEVAALLRW LEESVQF
SRSHVHLIGYSLGAHVSGFAGSSIGGTRKIGRITGLDAAG
PLF EGSSPSNRLSPDDANFVDAIHTFTREHMGLSVGIKQ
PIGHYDFYPNGGSF QPGCHFLELYRHIAKHGLNAITQTI
KCSHERSVHLFIDSLLHAGTQSVAY LCSDMDSFSQGLCL
SCKKGRCNTLGYHVRQEPRSKSKKLFLVTRAQSPFK VYH
YQFKIQFINQTETPIQTTFTMSLLGTKEKMQKIAITLGKG
IASNKTY SFLITLDVDIGELIMIKFKWESSAVWANVWNT
VQTIIPWSTGPRHPGLVL KTIRVKAGETQQRMTFCSENT
DDLQLRPTQEKIFVKCEIKSKTSKQKIR

References

Title : Genome sequencing and comparison of two nonhuman primate animal models, the cynomolgus and Chinese rhesus macaques - Yan_2011_Nat.Biotechnol_29_1019
Author(s) : Yan G , Zhang G , Fang X , Zhang Y , Li C , Ling F , Cooper DN , Li Q , Li Y , van Gool AJ , Du H , Chen J , Chen R , Zhang P , Huang Z , Thompson JR , Meng Y , Bai Y , Wang J , Zhuo M , Wang T , Huang Y , Wei L , Li J , Wang Z , Hu H , Yang P , Le L , Stenson PD , Li B , Liu X , Ball EV , An N , Huang Q , Fan W , Zhang X , Wang W , Katze MG , Su B , Nielsen R , Yang H , Wang X
Ref : Nat Biotechnol , 29 :1019 , 2011
Abstract : Yan_2011_Nat.Biotechnol_29_1019
ESTHER : Yan_2011_Nat.Biotechnol_29_1019
PubMedSearch : Yan_2011_Nat.Biotechnol_29_1019
PubMedID: 22002653
Gene_locus related to this paper: macfa-BCHE , macfa-g7nzc0 , macfa-g7nze2 , macfa-g7p4b9 , macfa-g7pa87 , macfa-g7pd01 , macfa-g7q259 , macfa-3neur , macfa-g8f585 , macfa-KANSL3 , macfa-q4r8p0 , macfa-SPG21 , macfa-TEX30 , macmu-3neur , macmu-ACHE , macmu-BCHE , macmu-f6sz31 , macmu-f6the6 , macmu-f6zkq5 , macmu-f7buk8 , macmu-f7cfi8 , macmu-f7flv1 , macmu-f7ggk1 , macmu-f7hir7 , macmu-g7n054 , macmu-g7npb8 , macmu-g7nq39 , macmu-KANSL3 , macmu-TEX30 , macfa-g7pgg6 , macmu-g7n4x3 , macfa-g7nzx2 , macfa-g8f4f7 , macmu-f7ba84 , macfa-g7psx7 , macmu-h9er02 , macfa-g8f3k0 , macfa-a0a2k5w1n7 , macmu-g7mxj6 , macfa-g7pbk1 , macfa-a0a2k5urk5 , macfa-a0a2k5wye4 , macfa-g7pe14 , macmu-f7hkw9 , macmu-f7hm08 , macmu-g7mke4 , macfa-g7nxn9 , macmu-a0a1d5rh04 , macmu-h9fud6 , macfa-g8f3e1 , macfa-i7gcw6 , macmu-f6qwx1 , macmu-f7h4t2 , macfa-a0a2k5wkd0 , macfa-a0a2k5v7v4 , macfa-g7p7y3 , macfa-a0a2k5uqq3 , macmu-i2cu80 , macfa-g8f5i1 , macmu-f7h550 , macmu-f7gkb9 , macfa-a0a2k5tui1