myobr-s7mux2

Myotis brandtii (Brandt's bat); Myotis lucifugus. Monoglyceride lipase

Comment

"Other strains: Myotis lucifugus\; Myotis brandtii (Little brown bat, Brandt's bat)"

Relationship

Family : Monoglyceridelipase_lysophospholip

Block : X

Position in NCBI Life Tree : Myotis brandtii

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MPRSDLGDEGTALICPALICPALILQAVVAVECPNQDMME
TGLGDPFRMP EESSPRRTPQNVPYQDLPHLVNADGQYLF
CRYWKPAGSPKGLVFVSHGAG EHCGRYDELAQMLVGLQL
LVFAHDHVGHGQSEGERMVVSDFHVFVRDALQ HVDAVQK
DHPGLPVFLLGHSMGGAIAILTAAERPSHFSGMVLISPLV
LAS PESATTFKVLAAKVLNVVLPNMSLGPIDSSVLSRNK
TEVDLYNTDPLICR AGMKVSFGMQLLNAVSRVERALPKL
TLPFLLLQGSADRLCDSKGAYLLME SAKSQDKTLKIYEG
AYHVLHKELPEVTNSVFHEIKMWVSQRTAAARTGSP P

References

Title : Genome analysis reveals insights into physiology and longevity of the Brandt's bat Myotis brandtii - Seim_2013_Nat.Commun_4_2212
Author(s) : Seim I , Fang X , Xiong Z , Lobanov AV , Huang Z , Ma S , Feng Y , Turanov AA , Zhu Y , Lenz TL , Gerashchenko MV , Fan D , Hee Yim S , Yao X , Jordan D , Xiong Y , Ma Y , Lyapunov AN , Chen G , Kulakova OI , Sun Y , Lee SG , Bronson RT , Moskalev AA , Sunyaev SR , Zhang G , Krogh A , Wang J , Gladyshev VN
Ref : Nat Commun , 4 :2212 , 2013
Abstract : Seim_2013_Nat.Commun_4_2212
ESTHER : Seim_2013_Nat.Commun_4_2212
PubMedSearch : Seim_2013_Nat.Commun_4_2212
PubMedID: 23962925
Gene_locus related to this paper: myobr-s7mf99 , myobr-s7n4r2 , myobr-s7neb7 , myobr-s7ney7 , myobr-s7n9l2 , myobr-s7nk13 , myobr-s7mh20 , myobr-s7pbt8 , myobr-s7mux2 , myobr-s7mjb5 , myobr-s7n6x5 , myobr-s7nnt6 , myobr-s7n728.2 , myobr-s7n728.3 , myobr-s7n8d2 , myobr-s7nqw0 , myobr-s7mju4 , myolu-g1nth4 , myobr-s7mij5 , myobr-s7pr94 , myolu-g1q4e3 , myolu-g1p353