syny3-y249

Synechocystis sp. (strain PCC 6803) Uncharacterized protein sll0249

Comment

Relationship

Family : AlphaBeta_hydrolase

Block : X

Position in NCBI Life Tree : Synechocystis sp.

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MTNQNMPPETPIIWLNFSPALRRFDRPLLRQLGKSQAILQ
WDYHQTADEP NCLTVGLDLIGEYLENFHQPVHLIGHSTS
GLLALLYARQCPEKVRSLSLL SVGVYPALDWQAHYYSQF
DAMRYSRHLLLGQMAHHLFNCRSLRQTQTIVN ILENDLL
TSISPHSLYKQLIILPNHIAVPLLVAVGETDGIIDTSLFN
GWQ RWKKPGDRLWLCPEGKYFFQFEHPEITAFQLQQFWR
SLQGQEASSSTSLL A

References

Title : Sequence analysis of the genome of the unicellular cyanobacterium Synechocystis sp. strain PCC6803. II. Sequence determination of the entire genome and assignment of potential protein-coding regions - Kaneko_1996_DNA.Res_3_109
Author(s) : Kaneko T , Sato S , Kotani H , Tanaka A , Asamizu E , Nakamura Y , Miyajima N , Hirosawa M , Sugiura M , Sasamoto S , Kimura T , Hosouchi T , Matsuno A , Muraki A , Nakazaki N , Naruo K , Okumura S , Shimpo S , Takeuchi C , Wada T , Watanabe A , Yamada M , Yasuda M , Tabata S
Ref : DNA Research , 3 :109 , 1996
Abstract : Kaneko_1996_DNA.Res_3_109
ESTHER : Kaneko_1996_DNA.Res_3_109
PubMedSearch : Kaneko_1996_DNA.Res_3_109
PubMedID: 8905231
Gene_locus related to this paper: synsp-ester , synsp-PHBC , synsp-prxc , synsp-Q55130 , synsp-SLL0482 , synsp-sll0553 , synsp-SLL0992 , synsp-sll1305 , synsp-SLL1969 , synsp-SLR0825 , synsp-slr1235 , synsp-SLR1506 , synsp-SLR1771 , synsp-SLR1807 , synsp-slr1827 , synsp-slr1916 , synsp-slr1917 , synsp-slr1932 , synsp-SLR1944 , synsp-SLR2053 , synsp-todF , syny3-dlhh , syny3-P73192 , syny3-p73194 , syny3-y249 , syny3-y264