syny3-y264

Synechocystis sp. (strain PCC 6803) hypothetical 41.0 kda protein slr0264

Comment

Relationship

Family : abh_upf0017

Block : X

Position in NCBI Life Tree : Synechocystis sp. (strain PCC 6803)

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MRSPLLAPSEKCQAWPRFTPPWYLSSGLAMTLYTAFVANQ
RCLNSARTRE PEYISQVMTGSQGVPLHVWRSPIPSQAKG
TLIATYGITGSLEDQGFLRQW GRWAYERHYDVILFDWRA
HGKTAELSPTLTSDGLYEGEDFVYLAAQAKAL GYPGPFW
FGGYSLGGQLSLWGVYKGQTLADWGNNDAMLTSFSPTDIG
GAM AICPSLDSQRSLNYLTSHPVGRYLEKAIANKLKELA
WQLHRHHPGEFDSQ AIERANTIWGFDHNLVIDRLGLASV
EDYYEVSSALPLLSKIVKPTLLLYA ADDPMFHPAIVEEL
PGLQNQLTGVDLQITPKGGHVGYIANGPCQQASNDP DEN
WAIHRTLDWLDQKSLA

References

Title : Sequence analysis of the genome of the unicellular cyanobacterium Synechocystis sp. strain PCC6803. II. Sequence determination of the entire genome and assignment of potential protein-coding regions - Kaneko_1996_DNA.Res_3_109
Author(s) : Kaneko T , Sato S , Kotani H , Tanaka A , Asamizu E , Nakamura Y , Miyajima N , Hirosawa M , Sugiura M , Sasamoto S , Kimura T , Hosouchi T , Matsuno A , Muraki A , Nakazaki N , Naruo K , Okumura S , Shimpo S , Takeuchi C , Wada T , Watanabe A , Yamada M , Yasuda M , Tabata S
Ref : DNA Research , 3 :109 , 1996
Abstract : Kaneko_1996_DNA.Res_3_109
ESTHER : Kaneko_1996_DNA.Res_3_109
PubMedSearch : Kaneko_1996_DNA.Res_3_109
PubMedID: 8905231
Gene_locus related to this paper: synsp-ester , synsp-PHBC , synsp-prxc , synsp-Q55130 , synsp-SLL0482 , synsp-sll0553 , synsp-SLL0992 , synsp-sll1305 , synsp-SLL1969 , synsp-SLR0825 , synsp-slr1235 , synsp-SLR1506 , synsp-SLR1771 , synsp-SLR1807 , synsp-slr1827 , synsp-slr1916 , synsp-slr1917 , synsp-slr1932 , synsp-SLR1944 , synsp-SLR2053 , synsp-todF , syny3-dlhh , syny3-P73192 , syny3-p73194 , syny3-y249 , syny3-y264