Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aciad-q6fc40

Acinetobacter sp., Acinetobacter calcoaceticus, hypothetical protein

Comment
Other strains: Acinetobacter sp. (strain ADP1; JCM 1667 / KCTC 23045 / DR1) Acinetobacter calcoaceticus (strain PHEA-2) hypothetical protein . E3NVL8 E3NVL8_CAERE Caenorhabditis remanei (Caenorhabditis vulgaris) Putative uncharacterized protein is probably a bacterial contaminant of the nematode


Relationship
Family|Fungal-Bact_LIP
Block| X
Position in NCBI Life Tree|Acinetobacter sp.
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Acinetobacter: N E > Acinetobacter sp.: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : CR543861, CP002177, CP002080
3 UniProt : Q6FC40, F0KP83, D8JK06
>3 UniProt links 1 more: Q6FC40, F0KP83, E3NVL8
>3 Interpro links 1 more: Q6FC40, F0KP83, E3NVL8
>3 Prodom links 1 more: Q6FC40, F0KP83, E3NVL8
>3 Pfam links 1 more: Q6FC40, F0KP83, E3NVL8
>3 PIRSF links 1 more: Q6FC40, F0KP83, E3NVL8
>3 SUPERFAM links 1 more: Q6FC40, F0KP83, E3NVL8
Sequence
Graphical view for this peptide sequence: aciad-q6fc40
Colored MSA for Fungal-Bact_LIP (raw)
MKAKHLTQLLKASFLSCSMIATTLSMAQLPPAPQEKYGDGRVSEFYTWKS
AIPAQPGKLLRTEAVHNPYIRLANDSQAIRILYSSTSGKDSKTPIVVSGS
IHLPKGNPPKEGWPVVLWAHGTVGLADACAPSWSGRSYRDVQYLNRWLNE
GFAVVATDYEGLGVAGPHLLINNPMLAYSILDSGRAALKTKLPLANKFVI
VGQSQGGAGAVAASSYSATYAPDLNIKGSIGTGVIYKDPEATPEKNQLKL
NPYEVSPSLAYGIYSFLVTQSLYPEIKTEEIFTPEAAPLVEQARNACLTS
FMGDIQTAGLSPAQAYKPNPPTSYKKLQEKESNDYGYYPTLKISHPLFIG
TGANDRTPDARSQMKLVADACKAGTVVEGHLYHGLGHSETVNASLKDSIP
FAKKVIAGEKIQAICKPDLQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKAKHLTQLLKASFLSCSMIATTLSMAQLPPAPQEKYGDGRVSEFYTWKS
AIPAQPGKLLRTEAVHNPYIRLANDSQAIRILYSSTSGKDSKTPIVVSGS
IHLPKGNPPKEGWPVVLWAHGTVGLADACAPSWSGRSYRDVQYLNRWLNE
GFAVVATDYEGLGVAGPHLLINNPMLAYSILDSGRAALKTKLPLANKFVI
VGQSQGGAGAVAASSYSATYAPDLNIKGSIGTGVIYKDPEATPEKNQLKL
NPYEVSPSLAYGIYSFLVTQSLYPEIKTEEIFTPEAAPLVEQARNACLTS
FMGDIQTAGLSPAQAYKPNPPTSYKKLQEKESNDYGYYPTLKISHPLFIG
TGANDRTPDARSQMKLVADACKAGTVVEGHLYHGLGHSETVNASLKDSIP
FAKKVIAGEKIQAICKPDLQ


References
    Title: Genome sequence of Acinetobacter calcoaceticus PHEA-2, isolated from industry wastewater
    Zhan Y, Yan Y, Zhang W, Yu H, Chen M, Lu W, Ping S, Peng Z, Yuan M and Lin M <2 more author(s)>
    Ref: Journal of Bacteriology, 193:2672, 2011 : PubMed

            

    Title: Complete genome sequence of the diesel-degrading Acinetobacter sp. strain DR1
    Jung J, Baek JH, Park W
    Ref: Journal of Bacteriology, 192:4794, 2010 : PubMed

            

    Title: Unique features revealed by the genome sequence of Acinetobacter sp. ADP1, a versatile and naturally transformation competent bacterium
    Barbe V, Vallenet D, Fonknechten N, Kreimeyer A, Oztas S, Labarre L, Cruveiller S, Robert C, Duprat S and Medigue C <5 more author(s)>
    Ref: Nucleic Acids Research, 32:5766, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer