Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: agrsh-f0lb16

Agrobacterium sp. ,Rhizobium lupini, Agrobacterium tumefaciens, Beta-ketoadipate enol-lactone hydrolase

Comment
Other strains: Agrobacterium sp. (strain H13-3), Rhizobium lupini (strain H13-3) Agrobacterium tumefaciens (5A; LBA4213 (Ach5))


Relationship
Family|Carboxymethylbutenolide_lactonase
Block| X
Position in NCBI Life Tree|Agrobacterium sp.
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Rhizobiaceae: N E > Rhizobium/Agrobacterium group: N E > Agrobacterium: N E > Agrobacterium sp.: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : CP002249, AGVZ01000006, CP007226
1 UniProt : F0LB16
1 UniProt : F0LB16
1 Interpro : F0LB16
1 Pfam : F0LB16
1 PIRSF : F0LB16
1 SUPERFAM : F0LB16
Sequence
Graphical view for this peptide sequence: agrsh-f0lb16
Colored MSA for Carboxymethylbutenolide_lactonase (raw)
MHFLRCGENAIHYRAHELESGKPVIAFINSLGTDFRIWDAVIAELGDKYA
FVLHDKRGHGLSDIGRPAYSIDDHADDLIAILDHLSVDNAVIWGLSVGGL
VAQGIYARRPDLVRALVLSNTAHRIGTAEMWNARIDKIAADGLASLIDPV
MERWFTPAFRQPDNLVYAGARNMLSQQPEAGYSGTCAAIRDADFTHEAGR
IAVPTLCVAGDEDGSTPPALVQSLADLIPASRLATIARCGHIPCLEQPLA
YAQAVGDFLKTLPEQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MHFLRCGENAIHYRAHELESGKPVIAFINSLGTDFRIWDAVIAELGDKYA
FVLHDKRGHGLSDIGRPAYSIDDHADDLIAILDHLSVDNAVIWGLSVGGL
VAQGIYARRPDLVRALVLSNTAHRIGTAEMWNARIDKIAADGLASLIDPV
MERWFTPAFRQPDNLVYAGARNMLSQQPEAGYSGTCAAIRDADFTHEAGR
IAVPTLCVAGDEDGSTPPALVQSLADLIPASRLATIARCGHIPCLEQPLA
YAQAVGDFLKTLPEQ


References
    Title: Genome Sequence of the Octopine-Type Agrobacterium tumefaciens Strain Ach5
    Henkel CV, den Dulk-Ras A, Zhang X, Hooykaas PJ
    Ref: Genome Announc, 2:e00225, 2014 : PubMed

            

    Title: Genome sequence of the arsenite-oxidizing strain Agrobacterium tumefaciens 5A
    Hao X, Lin Y, Johnstone L, Liu G, Wang G, Wei G, McDermott T, Rensing C
    Ref: Journal of Bacteriology, 194:903, 2012 : PubMed

            

    Title: Complete genome sequencing of Agrobacterium sp. H13-3, the former Rhizobium lupini H13-3, reveals a tripartite genome consisting of a circular and a linear chromosome and an accessory plasmid but lacking a tumor-inducing Ti-plasmid
    Wibberg D, Blom J, Jaenicke S, Kollin F, Rupp O, Scharf B, Schneiker-Bekel S, Sczcepanowski R, Goesmann A and Schluter A <3 more author(s)>
    Ref: J Biotechnol, 155:50, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer