Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: anapl-r0lhc4

Anas platyrhynchos (Mallard) (Anas boschas); Anas platyrhynchos platyrhynchos (Northern mallard). Abhydrolase domain-containing protein 13

Comment
Other strains: Anas platyrhynchos (Mallard) (Anas boschas); Anas platyrhynchos platyrhynchos (Northern mallard)


Relationship
Family|ABHD13-BEM46
Block| X
Position in NCBI Life Tree|Anas platyrhynchos
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Sauropsida: N E > Sauria: N E > Archelosauria: N E > Archosauria: N E > Dinosauria: N E > Saurischia: N E > Theropoda: N E > Coelurosauria: N E > Aves: N E > Neognathae: N E > Galloanserae: N E > Anseriformes: N E > Anatidae: N E > Anas: N E > Anas platyrhynchos: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : KB743282, XP_005021793, XP_012957045
2 UniProt : R0LHC4, U3I1F2
2 UniProt : R0LHC4, U3I1F2
2 Interpro : R0LHC4, U3I1F2
2 Pfam : R0LHC4, U3I1F2
2 PIRSF : R0LHC4, U3I1F2
2 SUPERFAM : R0LHC4, U3I1F2
Sequence
Graphical view for this peptide sequence: anapl-r0lhc4
Colored MSA for ABHD13-BEM46 (raw)
MEKSWMLWTFVERWLLALASWSWGLCRISLLPLIVTFHLYGGIILLVLIF
VSIAGILYKFQDVLLYFPEQPSSSRLYVPMPTGIPHENIFIKTKDGVLLN
LILLRYTGDNAAYSPTIIYFHGNAGNIGHRLPNALLMLVNLKVNLILVDY
RGYGKSEGEASEEGLYLDSEAVLDYVMTRSDLDKTKIFLFGRSLGGAVAI
HLASENSHRISAIMVENTFLSIPHMASTLFSFFPMRYLPLWCYKNKFLSY
RKISQCRMPSLFISGLSDQLIPPVMMKQLYELSPARTKRLAIFPDGTHND
TWQCQGYFTALEQFIKEVIKSHSPEEMAKTSSNVTII
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEKSWMLWTFVERWLLALASWSWGLCRISLLPLIVTFHLYGGIILLVLIF
VSIAGILYKFQDVLLYFPEQPSSSRLYVPMPTGIPHENIFIKTKDGVLLN
LILLRYTGDNAAYSPTIIYFHGNAGNIGHRLPNALLMLVNLKVNLILVDY
RGYGKSEGEASEEGLYLDSEAVLDYVMTRSDLDKTKIFLFGRSLGGAVAI
HLASENSHRISAIMVENTFLSIPHMASTLFSFFPMRYLPLWCYKNKFLSY
RKISQCRMPSLFISGLSDQLIPPVMMKQLYELSPARTKRLAIFPDGTHND
TWQCQGYFTALEQFIKEVIKSHSPEEMAKTSSNVTII


Reference
    Title: The duck genome and transcriptome provide insight into an avian influenza virus reservoir species
    Huang Y, Li Y, Burt DW, Chen H, Zhang Y, Qian W, Kim H, Gan S, Zhao Y and Li N <40 more author(s)>
    Ref: Nat Genet, 45:776, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer