Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: antpo-tegest

Antheraea polyphemus putative integumental esterase Apol-IE

Comment
Ishida Y., Leal W.S


Relationship
Family|Carb_B_Arthropoda
Block| C
Position in NCBI Life Tree|Antheraea polyphemus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Amphiesmenoptera: N E > Lepidoptera: N E > Glossata: N E > Neolepidoptera: N E > Heteroneura: N E > Ditrysia: N E > Obtectomera: N E > Bombycoidea: N E > Saturniidae: N E > Saturniinae: N E > Saturniini: N E > Antheraea: N E > Antheraea polyphemus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





1 substrate:
E6Z11-16Ac
No inhibitor
2 Genbank : AY091504, AB072256
1 Ncbi-nid : 29465747
1 Ncbi-pid : 29465748
2 UniProt : Q86MC6, Q76LV8
2 Interpro : Q86MC6, Q76LV8
2 Pfam : Q86MC6, Q76LV8
2 PIRSF : Q86MC6, Q76LV8
2 SUPERFAM : Q86MC6, Q76LV8
Sequence
Graphical view for this peptide sequence: antpo-tegest
Colored MSA for Carb_B_Arthropoda (raw)
MFYKLLFCLCIVAAHAGEQDTSKTADCKTHKDEVPIATSQSGVFRGSWMT
TRRGRRFQAYRGIRYAEPPVGELRFQPPKPILYYKDVVDASKEGPACPLP
VPDDYYVDEDCLAINVYTPNNKVKKPLPVIMYIHPGAFYAFTGRSDVAGP
GYLLDRDIVFVAFNYRLATLGFMSTGDKLAPGNNGMKDQVMAMRWVQRNI
AAFGGDPNSVTLAGYSAGSISVMLHMISPMSKGLFHRGISMSASPINKEP
LPNNFQSLAVKQAQIVNCSTASNQAIVDCLKTISWKVLGDSLPQFFVGGD
PIGLWGPVVENDFGQERFLDIQPLDAIRQGRFHSVPHIISQTKYEFFYQV
FELFKNDTLITRMNDDWETAARVSFLLPEKNIRAAANKLKEVYLEGKPVA
KDNRTIQGVGGLYRDSITSLGVHRMANLMCRHSKHPVYYYEFSYFGDNSH
YEDPVTGKPFGAVHHDDLIYLLTMSYRFPVIETTSPHSYVIDEMTALWYN
FARYDDPNPRGDTPELNSLVWPVMKPDDRKYLRIGNKLTVHKNMFEDRYK
VWDELYPIQY
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MFYKLLFCLCIVAAHAGEQDTSKTADCKTHKDEVPIATSQSGVFRGSWMT
TRRGRRFQAYRGIRYAEPPVGELRFQPPKPILYYKDVVDASKEGPACPLP
VPDDYYVDEDCLAINVYTPNNKVKKPLPVIMYIHPGAFYAFTGRSDVAGP
GYLLDRDIVFVAFNYRLATLGFMSTGDKLAPGNNGMKDQVMAMRWVQRNI
AAFGGDPNSVTLAGYSAGSISVMLHMISPMSKGLFHRGISMSASPINKEP
LPNNFQSLAVKQAQIVNCSTASNQAIVDCLKTISWKVLGDSLPQFFVGGD
PIGLWGPVVENDFGQERFLDIQPLDAIRQGRFHSVPHIISQTKYEFFYQV
FELFKNDTLITRMNDDWETAARVSFLLPEKNIRAAANKLKEVYLEGKPVA
KDNRTIQGVGGLYRDSITSLGVHRMANLMCRHSKHPVYYYEFSYFGDNSH
YEDPVTGKPFGAVHHDDLIYLLTMSYRFPVIETTSPHSYVIDEMTALWYN
FARYDDPNPRGDTPELNSLVWPVMKPDDRKYLRIGNKLTVHKNMFEDRYK
VWDELYPIQY


References
    Title: Cloning of putative odorant-degrading enzyme and integumental esterase cDNAs from the wild silkmoth, Antheraea polyphemus
    Ishida Y, Leal WS
    Ref: Insect Biochemistry & Molecular Biology, 32:1775, 2002 : PubMed

            

    Title: Pheromone binding and inactivation by moth antennae
    Vogt RG, Riddiford LM
    Ref: Nature, 293:161, 1981 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer