Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: beaba-a0a2s7xwt2

Beauveria bassiana (White muscardine disease fungus) (Tritirachium shiotae); Beauveria brongniartii. Uncharacterized protein

Comment
Other strains: Beauveria bassiana (White muscardine disease fungus) (Tritirachium shiotae)(D1-5; ARSEF 2860); Beauveria brongniartii RCEF 3172


Relationship
Family|Arb2_domain
Block| X
Position in NCBI Life Tree|Beauveria bassiana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Hypocreales: N E > Cordycipitaceae: N E > Beauveria: N E > Beauveria bassiana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: beaba-a0a2s7xwt2
Colored MSA for Arb2_domain (raw)
RLHDVIRSAQQQALQAKHNMVPLYVQRDQISKSFENQVLVTPDLQDARRL
LVIIHDPPQLLAQPDVLDGSLQSHNSWVVDGVTQYIDWAVGQKFAVMDVN
VPAYVSQDADMEAYIPGYKERAIQEQMQSLMCYLWDNFLQLSDAEEIFLM
GVGDAYLGVKVLLINRDCKSRVSGVVNFVTGSLRPIKSDVDTELSAWYKS
NSRVYVAGNHACWSDHDLTRKVQKRRFGTVVRSETTGLNKMMRAHAEETQ
KWILERVADTRGETTEDEKLLQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

RLHDVIRSAQQQALQAKHNMVPLYVQRDQISKSFENQVLVTPDLQDARRL
LVIIHDPPQLLAQPDVLDGSLQSHNSWVVDGVTQYIDWAVGQKFAVMDVN
VPAYVSQDADMEAYIPGYKERAIQEQMQSLMCYLWDNFLQLSDAEEIFLM
GVGDAYLGVKVLLINRDCKSRVSGVVNFVTGSLRPIKSDVDTELSAWYKS
NSRVYVAGNHACWSDHDLTRKVQKRRFGTVVRSETTGLNKMMRAHAEETQ
KWILERVADTRGETTEDEKLLQ


References
    Title: Characterization of T-DNA insertion mutants with decreased virulence in the entomopathogenic fungus Beauveria bassiana JEF-007
    Kim S, Lee SJ, Nai YS, Yu JS, Lee MR, Yang YT, Kim JS
    Ref: Applied Microbiology & Biotechnology, 100:8889, 2016 : PubMed

            

    Title: Divergent and Convergent Evolution of Fungal Pathogenicity
    Shang Y, Xiao G, Zheng P, Cen K, Zhan S, Wang C
    Ref: Genome Biol Evol, 8:1374, 2016 : PubMed

            

    Title: Genomic perspectives on the evolution of fungal entomopathogenicity in Beauveria bassiana
    Xiao G, Ying SH, Zheng P, Wang ZL, Zhang S, Xie XQ, Shang Y, St Leger RJ, Zhao GP and Feng MG <1 more author(s)>
    Ref: Sci Rep, 2:483, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer