Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: celju-metx

Cellvibrio japonicus (strain Ueda107) (Pseudomonas fluorescens subsp cellulosa) Homoserine O-trans-acetylase

Relationship
Family|Homoserine_transacetylase
Block| X
Position in NCBI Life Tree|Cellvibrio japonicus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Cellvibrionales: N E > Cellvibrionaceae: N E > Cellvibrio: N E > Cellvibrio japonicus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP000934
1 UniProt : B3PFK3
1 UniProt : B3PFK3
1 Interpro : B3PFK3
1 Pfam : B3PFK3
1 PIRSF : B3PFK3
1 SUPERFAM : B3PFK3
Sequence
Graphical view for this peptide sequence: celju-metx
Colored MSA for Homoserine_transacetylase (raw)
MPNQLPADSVGLVTPQTLHFSEPLELACGISLNEYDLVYETYGQLNAAKS
NAVLICHALSGHHHAAGYHRLEDKRPGWWDAYIGPGKPIDTNKFFVVALN
NLGGCHGSTGPRSINPATGNVWGADFPMLRVRDWVASQARLADALGIDTW
AAIIGGSLGGMQVMRWSIQYPQRVRYAVVIASAMKLSAQNIAFNEAARKA
IISDPNFHNGDYLAHNTLPKNGLAVARMIGHITYLSDYAMGEKFGRDLRS
GSFELGIAEPVEFQIESYLRYQGDSFAVSFDANSYIRITKALDYFDLARE
YSDDPVLAFQGAQAKFLVVSFSTDWRFAPQRSREIVDALVGANKAVTYAE
IESKHGHDAFLLPDARYEQVFKRYLASVEV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPNQLPADSVGLVTPQTLHFSEPLELACGISLNEYDLVYETYGQLNAAKS
NAVLICHALSGHHHAAGYHRLEDKRPGWWDAYIGPGKPIDTNKFFVVALN
NLGGCHGSTGPRSINPATGNVWGADFPMLRVRDWVASQARLADALGIDTW
AAIIGGSLGGMQVMRWSIQYPQRVRYAVVIASAMKLSAQNIAFNEAARKA
IISDPNFHNGDYLAHNTLPKNGLAVARMIGHITYLSDYAMGEKFGRDLRS
GSFELGIAEPVEFQIESYLRYQGDSFAVSFDANSYIRITKALDYFDLARE
YSDDPVLAFQGAQAKFLVVSFSTDWRFAPQRSREIVDALVGANKAVTYAE
IESKHGHDAFLLPDARYEQVFKRYLASVEV


Reference
    Title: Insights into plant cell wall degradation from the genome sequence of the soil bacterium Cellvibrio japonicus
    DeBoy RT, Mongodin EF, Fouts DE, Tailford LE, Khouri H, Emerson JB, Mohamoud Y, Watkins K, Henrissat B and Nelson KE <1 more author(s)>
    Ref: Journal of Bacteriology, 190:5455, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer