(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Eukaryota: NE > Opisthokonta: NE > Metazoa: NE > Eumetazoa: NE > Bilateria: NE > Protostomia: NE > Ecdysozoa: NE > Panarthropoda: NE > Arthropoda: NE > Mandibulata: NE > Pancrustacea: NE > Hexapoda: NE > Insecta: NE > Dicondylia: NE > Pterygota: NE > Neoptera: NE > Holometabola: NE > Diptera: NE > Nematocera: NE > Culicomorpha: NE > Culicoidea: NE > Culicidae: NE > Culicinae: NE > Culicini: NE > Culex [genus]: NE > Culex [subgenus]: NE > Culex pipiens complex: NE > Culex quinquefasciatus: NE
A85-EsteraseD-FGH : culqu-b0x7u1Culex quinquefasciatus (Southern house mosquito) (Culex pungens) S-formylglutathione hydrolase. ABHD11-Acetyl_transferase : culqu-b0x0a6Culex quinquefasciatus (Southern house mosquito) (Culex pungens). Esterase ybfF. ABHD12-PHARC : culqu-b0wf88Culex quinquefasciatus (Southern house mosquito) (Culex pungens). Putative uncharacterized protein. ABHD13-BEM46 : culqu-b0wi47Culex quinquefasciatus (Southern house mosquito) (Culex pungens). Abhydrolase domain-containing protein 13. ABHD18 : culqu-b0w4e1Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Putative uncharacterized protein. abh_upf0017 : culqu-b0w5m5Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Putative uncharacterized protein, culqu-b0wpz0Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Putative uncharacterized protein. ACHE : culqu-ACHE1Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Acetylcholinesterase 1, culqu-ACHE2Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Acetylcholinesterase 2. Acidic_Lipase : culqu-b0w003Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Lipase, culqu-b0w004Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Lipase, culqu-b0w6g4Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Lipase, culqu-b0w6g5Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Lipase, culqu-b0w6g6Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Lipase, culqu-b0w6g7Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Lipase, culqu-b0w6g8Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Lipase, culqu-b0w6g9Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Lipase, culqu-b0w6h1Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Lipase, culqu-b0w6h2Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Lipase, culqu-b0w6h3Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Lipase, culqu-b0w6h4Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Lipase, culqu-b0wdk6Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Lipase, culqu-b0we24Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Lipase 1, culqu-b0wnv4Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Lipase, culqu-b0wxv5Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Lipase, culqu-b0x4a4Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Lysosomal acid lipase, culqu-b0xc32Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Lipase. Carb_B_Arthropoda : culqu-2estbCulex quinquefasciatus (Southern house mosquito) serine esterase B, culqu-3estbCulex quinquefasciatus (PelSS) mRNA for serine esterase B, culqu-b0vz13Culex quinquefasciatus (Southern house mosquito) Carboxylesterase, culqu-b0vz17Culex quinquefasciatus (Southern house mosquito) Carboxylesterase, culqu-b0vz20Culex quinquefasciatus (Southern house mosquito) Carboxylesterase, culqu-b0vz21Culex quinquefasciatus (Southern house mosquito) Carboxylesterase, culqu-b0w8a7Culex quinquefasciatus (Southern house mosquito) Carboxylesterase, culqu-b0w8a8Culex quinquefasciatus (Southern house mosquito) Carboxylesterase, culqu-b0w8a9Culex quinquefasciatus (Southern house mosquito) Glutactin, culqu-b0wbt7Culex quinquefasciatus (Southern house mosquito) Para-nitrobenzyl esterase, culqu-b0wbt8Culex quinquefasciatus (Southern house mosquito) Glutactin, culqu-b0wdn5Culex quinquefasciatus (Southern house mosquito) Esterase B1, culqu-b0wev9Culex quinquefasciatus (Southern house mosquito) Carboxylesterase, culqu-b0wih9Culex quinquefasciatus (Southern house mosquito) Carboxylesterase-6, culqu-b0wla4Culex quinquefasciatus (Southern house mosquito) Esterase B1, culqu-b0wla5Culex quinquefasciatus (Southern house mosquito) Para-nitrobenzyl esterase, culqu-b0wla6Culex quinquefasciatus (Southern house mosquito) Alpha-esterase, culqu-b0wla7Culex quinquefasciatus (Southern house mosquito) Carboxylesterase 2, culqu-b0wla8Culex quinquefasciatus (Southern house mosquito) Bile salt-activated lipase, culqu-b0wla9Culex quinquefasciatus (Southern house mosquito) Alpha-esterase, culqu-b0wnx0Culex quinquefasciatus (Southern house mosquito) Liver carboxylesterase 10, culqu-b0wuu5Culex quinquefasciatus (Southern house mosquito) Esterase E4, culqu-b0x2a0Culex quinquefasciatus (Southern house mosquito) Alpha-esterase, culqu-b0x9k7Culex quinquefasciatus (Southern house mosquito) Carboxylesterase, culqu-b0x9k8Culex quinquefasciatus (Southern house mosquito) Carboxylesterase, culqu-b0x746Culex quinquefasciatus (Southern house mosquito) Esterase B1, culqu-b0xam9Culex quinquefasciatus (Southern house mosquito) Esterase B1, culqu-b0xan0Culex quinquefasciatus (Southern house mosquito) Esterase-5A, culqu-b0xan2Culex quinquefasciatus (Southern house mosquito) Liver carboxylesterase 1, culqu-b0xan3Culex quinquefasciatus (Southern house mosquito) Esterase 6, culqu-b0xan4Culex quinquefasciatus (Southern house mosquito) Alpha-esterase, culqu-b0xaz2Culex quinquefasciatus (Southern house mosquito) Esterase FE4, culqu-b0xaz4Culex quinquefasciatus (Southern house mosquito) esterase, culqu-b0xaz6Culex quinquefasciatus (Southern house mosquito) Esterase FE4, culqu-b0xaz7Culex quinquefasciatus (Southern house mosquito) Esterase FE4, culqu-b0xek9Culex quinquefasciatus (Southern house mosquito) Juvenile hormone esterase, culqu-b0xfi1Culex quinquefasciatus (Southern house mosquito) Carboxylesterase, culqu-b0xfi2Culex quinquefasciatus (Southern house mosquito) esterase, culqu-b0xfi3Culex quinquefasciatus (Southern house mosquito) Carboxylesterase, culqu-b0xj03Culex quinquefasciatus (Southern house mosquito) esterase. CGI-58_ABHD5_ABHD4 : culqu-b0wpg8Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Abhydrolase domain-containing protein 4. DPP4N_Peptidase_S9 : culqu-b0we34Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Dipeptidyl peptidase 4, culqu-b0wxf5Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Dipeptidyl-peptidase, culqu-b0wyn8Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Dipeptidyl-peptidase, culqu-b0wyp7Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Dipeptidyl-peptidase. Epoxide_hydrolase : culqu-b0wft3Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Abhydrolase domain-containing protein 9, culqu-b0wiu7Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Epoxide hydrolase, culqu-b0xj28Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Abhydrolase domain-containing protein 7, culqu-b0xj30Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Abhydrolase domain-containing protein 9. Gliotactin : culqu-b0w0b8Culex quinquefasciatus (Southern house mosquito) Gliotactin. Insect_lipase : culqu-q6try9Culex quinquefasciatus (Southern house mosquito) putative salivary lipase (EC 3.1.1.3). Juvenile_hormone_esterase : culqu-b0w3q7Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Juvenile hormone esterase, culqu-b0w3q8Culex quinquefasciatus (Southern house mosquito) Gut esterase 1, culqu-b0w3q9Culex quinquefasciatus (Southern house mosquito) Lipase 4, culqu-b0x0i0Culex quinquefasciatus (Southern house mosquito) carboxylesterase 1, culqu-b0x0i1Culex quinquefasciatus (Southern house mosquito) Gut esterase 1, culqu-b0x0i2Culex quinquefasciatus (Southern house mosquito) Esterase 6, culqu-b0x0i3Culex quinquefasciatus (Southern house mosquito) Esterase FE4, culqu-b0x4q0Culex quinquefasciatus (Southern house mosquito) Esterase FE4, culqu-b0x225Culex quinquefasciatus (Southern house mosquito) Juvenile hormone esterase, culqu-b0xkv1Culex quinquefasciatus (Southern house mosquito) Juvenile hormone esterase. Kynurenine-formamidase : culqu-b0w291Culex quinquefasciatus (Southern house mosquito) (Culex pungens). N-formylkynurenine formamidase. LIDHydrolase : culqu-b0wiv0Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Putative uncharacterized protein. Ndr_family : culqu-b0w346Culex quinquefasciatus (Southern house mosquito) (Culex pungens) N-myc downstream regulated. Neurotactin : culqu-b0wnn8Culex quinquefasciatus (Southern house mosquito) Neurotactin. NLS3-Tex30 : culqu-b0wkn8Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Testis development protein prtd. OtherNon-catalytic_C : culqu-b0wji4Culex quinquefasciatus (Southern house mosquito) Carboxylesterase 3, culqu-b0wri2Culex quinquefasciatus (Southern house mosquito) Carboxylesterase. Pancreatic_lipase : culqu-b0vzr7Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Culex pipiens pallens. Pancreatic triacylglycerol lipase precursor, culqu-b0xik3Culex quinquefasciatus (Southern house mosquito) (Culex pungens). Pancreatic triacylglycerol lipase precursor. Pectinacetylesterase-Notum : culqu-b0wi51Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Notum. PPase_methylesterase_euk : culqu-b0wub2Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Protein phosphatase methylesterase 1. Prolylcarboxypeptidase : culqu-b0wgs7Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Prolylcarboxypeptidase, culqu-b0wgs8Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Prolylcarboxypeptidase, culqu-b0wjz7Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Thymus-specific serine protease, culqu-b0wp51Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Prolylcarboxypeptidase, culqu-b0wp52Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Prolylcarboxypeptidase, culqu-b0wp54Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Lysosomal pro-X carboxypeptidase, culqu-b0wp55Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Prolylcarboxypeptidase, culqu-b0wp56Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Prolylcarboxypeptidase, culqu-b0x1w0Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Lysosomal Pro-X carboxypeptidase, culqu-b0xf46Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Thymus-specific serine protease, culqu-b0xf47Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Thymus-specific serine protease. SERHL : culqu-b0w294Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Valacyclovir hydrolase, culqu-b0w295Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Valacyclovir hydrolase, culqu-b0w232Culex quinquefasciatus (Southern house mosquito) (Culex pungens). Valacyclovir hydrolase. Valacyclovir-hydrolase : culqu-b0w3i6Culex quinquefasciatus (Southern house mosquito) (Culex pungens) Bphl protein
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Culex pipiens: N, E.
Culex pipiens molestus: N, E.
Culex pipiens pallens: N, E.
Culex pipiens pipiens: N, E.
Culex quinquefasciatus quinquefasciatus: N, E.
Molecular evidence
Database
No mutation 1 structure: 5W1U: Culex quinquefasciatus carboxylesterase B2 No kinetic
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MSLESLTVQTKYGPVRGKRSVSLLGQEYVSFQGIPYARAPEGELRFKAPV PPQNWTETLDCSQQCEPCYHFDRRLQKIVGCEDSLKINVFAKEINPSKPL PVMLYIYGGGFTEGTSGTELYGPDFLVQKDIVLVSFNYRIGALGFLCCQS EQDGVPGNAGLKDQNLAIRWVLENIAAFGGDPKRVTLVGHSAGAASVQYH LISDASKDLFQRAIVMSGSTYNSWSLTRQRNWVEKLAKAIGWDGQGGESG ALRFLKAAKPEDIVANQEKLLTDQDMQDDIFTPFGPTVEPYLTEQCMIPK EPFEMARTAWGDKIDIMIGGTSEEGLLLLQKIKLQPELLSHPHLFLGNVP PNLKISMEKRIEFAAKLKQRYYPDSSPSMENNLGYVHMMSDRVFWHGLHR TILARAARSRARTFVYRICLDSEFYNHYRIMMIDPKLRGTAHADELSYLF SNFTQQVPGKETFEYRGLQTLVDVFTAFVINGDPNCGMTAKSGVVFEPNA QTKPTFKCLNIANDGVAFVDYPDADRLDMWDAMYVNDELF
References
Title: Structure of an Insecticide Sequestering Carboxylesterase from the Disease Vector Culex quinquefasciatus: What Makes an Enzyme a Good Insecticide Sponge? Hopkins DH, Fraser NJ, Mabbitt PD, Carr PD, Oakeshott JG, Jackson CJ Ref: Biochemistry, 56:5512, 2017 : PubMed
Carboxylesterase (CBE)-mediated metabolic resistance to organophosphate and carbamate insecticides is a major problem for the control of insect disease vectors, such as the mosquito. The most common mechanism involves overexpression of CBEs that bind to the insecticide with high affinity, thereby sequestering them before they can interact with their target. However, the absence of any structure for an insecticide-sequestering CBE limits our understanding of the molecular basis for this process. We present the first structure of a CBE involved in sequestration, Cqestbeta2(1), from the mosquito disease vector Culex quinquefasciatus. Lysine methylation was used to obtain the crystal structure of Cqestbeta2(1), which adopts a canonical alpha/beta-hydrolase fold that has high similarity to the target of organophosphate and carbamate insecticides, acetylcholinesterase. Sequence similarity networks of the insect carboxyl/cholinesterase family demonstrate that CBEs associated with metabolic insecticide resistance across many species share a level of similarity that distinguishes them from a variety of other classes. This is further emphasized by the structural similarities and differences in the binding pocket and active site residues of Cqestbeta2(1) and other insect carboxyl/cholinesterases. Stopped-flow and steady-state inhibition studies support a major role for Cqestbeta2(1) in organophosphate resistance and a minor role in carbamate resistance. Comparison with another isoform associated with insecticide resistance, Cqestbeta1, showed both enzymes have similar affinity to insecticides, despite 16 amino acid differences between the two proteins. This provides a molecular understanding of pesticide sequestration by insect CBEs and could facilitate the design of CBE-specific inhibitors to circumvent this resistance mechanism in the future.
        
Title: Characterization of novel esterases in insecticide-resistant mosquitoes Cui F, Weill M, Berthomieu A, Raymond M, Qiao CL Ref: Insect Biochemistry & Molecular Biology, 37:1131, 2007 : PubMed
In the mosquito Culex pipiens complex (Diptera: Culicidae), the amplification of carboxylesterase genes is an important mechanism providing resistance to organophosphate insecticides. Various amplified alleles at the Ester locus have been identified over the world. In this study, two newly detected Ester alleles, Ester(B10) and Ester(11) (including associated Ester(A11) and Ester(B11)), coding for esterases B10 and A11-B11, respectively, are characterized qualitatively and quantitatively. A high molecular identity is observed both at the nucleotide level and at the deduced amino acid level among the known Ester alleles. Real-time quantitative PCR results suggest 2.5-fold amplification of the Ester(B10) allele, 36.5-fold amplification of the Ester(A11) allele, and 19.1-fold amplification of the Ester(B11) allele. The ca. 2-fold difference in amplification level between Ester(A11) and Ester(B11) may indicate a new model for the esterase amplification. Bioassays show that these two resistant Ester alleles only can confer moderate or low resistance to the tested organophosphate insecticides.
        
Title: The independent gene amplification of electrophoretically indistinguishable B esterases from the insecticide-resistant mosquito Culex quinquefasciatus Vaughan A, Rodriguez M, Hemingway J Ref: Biochemical Journal, 305 ( Pt 2):651, 1995 : PubMed
Resistance to organophosphates in Culex mosquitoes is typically associated with increased activity of non-specific esterases. The commonest phenotype involves two elevated esterases, A2 and B2, while some strains have elevation of esterase B1 alone. Overexpression of the two B esterase electromorphs is due to gene amplification. Full-length cDNAs coding for amplified esterase B genes from a resistant Cuban strain (MRES, with amplified B1 esterase) and a Sri Lankan strain (PelRR, with amplified B2 esterase) of C. quinquefasciatus have been sequenced. In addition, a partial-length cDNA coding for a B esterase from an insecticide-susceptible Sri Lankan strain (PelSS) has been sequenced. All the nucleotide sequences and the inferred amino acid sequences show a high level of identify (> 95% at the nucleotide and amino acid level), confirming that they are an allelic series. The two B1 esterase nucleotide sequences (MRES and the previously published TEM-R [Mouches, Pauplin, Agarwal, Lemieux, Herzog, Abadon, Beyssat-Arnaouty, Hyrien, De Saint Vincent, Georghiou and Pasteur (1990) Proc. Natl. Acad. Sci. U.S.A. 87, 2574-2578]) showed the lowest identity, and restriction-fragment-length-polymorphism analysis of the two strains was different. On the basis of these data we suggest that the two electrophoretically identical B1 esterase isoenzymes from California and Cuba have been amplified independently. Alternatively, if amplification has occurred only once, the original amplification has not occurred recently.