Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: dugja-CHE2

Dugesia japonica (Planarian) Acetylcholinesterase ACHE2 DjChE2

Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Dugesia japonica
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Platyhelminthes: N E > Rhabditophora: N E > Seriata: N E > Tricladida: N E > Continenticola: N E > Geoplanoidea: N E > Dugesiidae: N E > Dugesia: N E > Dugesia japonica: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : IAAB01063496
Sequence
Graphical view for this peptide sequence: dugja-CHE2
Colored MSA for ACHE (raw)
MVMVSIYSQLVVKLVFIYFTICNVNISGVIFTKNISLNKKQYSLLGSEMI
VEGVTLDYFARIPYAMPPINKLRFKHPQEFVGDPWIGIYNSTVQPNTCWQ
ADGSEFDKLNPAVRLWLTNTNMSEDCLYLTIWSPKINTAKLPVMVWIYGG
SFFSGSSTLEVYDGSILAAKHEVVVVSLQYRLGPLGFLYFDDILAPGNQG
LMDQVLALKWIKNNIHNFNGDSNRITIFGESAGSVSVSLHLLSPLSKNYF
NRAIMESATAVASWAVETKQESKEKGILLSKFVDCNYDQKINDRIIRCLQ
NVSPDQLVAKQFDLKTFTNKQRTDLLISRGVKHLYTDASFFFDIFFRPVY
DNFFIPNSIDLLMNESKSNSNKEILLGYNANEGMFFLLYGLNKWLNFFNK
DKVQDTSMLSSDTPNYTKVSNFILENLATNDMAYSNLLPLLLYEYKIPST
ITGWKKWNSTQVLSALDQLTGDQQFVCSVIDYAEIMADNNFKVYMYSFQH
RTTRTTFPKWTGTMHGYEIEYVFGMPFSEKFQKLFYSFTEDEKKLSQYTM
KMWTNFAKYGNPTINKIDYFGSSVSWPLYNTTNKLSFFFTTPQDTSLTPV
KINDKSMKCKFWNKVIPSITSMFEKVKNMSPSLNEMVWTNIMIILLSVWI
TVNIL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVMVSIYSQLVVKLVFIYFTICNVNISGVIFTKNISLNKKQYSLLGSEMI
VEGVTLDYFARIPYAMPPINKLRFKHPQEFVGDPWIGIYNSTVQPNTCWQ
ADGSEFDKLNPAVRLWLTNTNMSEDCLYLTIWSPKINTAKLPVMVWIYGG
SFFSGSSTLEVYDGSILAAKHEVVVVSLQYRLGPLGFLYFDDILAPGNQG
LMDQVLALKWIKNNIHNFNGDSNRITIFGESAGSVSVSLHLLSPLSKNYF
NRAIMESATAVASWAVETKQESKEKGILLSKFVDCNYDQKINDRIIRCLQ
NVSPDQLVAKQFDLKTFTNKQRTDLLISRGVKHLYTDASFFFDIFFRPVY
DNFFIPNSIDLLMNESKSNSNKEILLGYNANEGMFFLLYGLNKWLNFFNK
DKVQDTSMLSSDTPNYTKVSNFILENLATNDMAYSNLLPLLLYEYKIPST
ITGWKKWNSTQVLSALDQLTGDQQFVCSVIDYAEIMADNNFKVYMYSFQH
RTTRTTFPKWTGTMHGYEIEYVFGMPFSEKFQKLFYSFTEDEKKLSQYTM
KMWTNFAKYGNPTINKIDYFGSSVSWPLYNTTNKLSFFFTTPQDTSLTPV
KINDKSMKCKFWNKVIPSITSMFEKVKNMSPSLNEMVWTNIMIILLSVWI
TVNIL


References
1 more
    Title: Planarian cholinesterase: molecular and functional characterization of an evolutionarily ancient enzyme to study organophosphorus pesticide toxicity
    Hagstrom D, Zhang S, Ho A, Tsai ES, Radic Z, Jahromi A, Kaj KJ, He Y, Taylor P, Collins ES
    Ref: Archives of Toxicology, 92:1161, 2018 : PubMed

            

    Title: Planarian cholinesterase: in vitro characterization of an evolutionarily ancient enzyme to study organophosphorus pesticide toxicity and reactivation
    Hagstrom D, Hirokawa H, Zhang L, Radic Z, Taylor P, Collins ES
    Ref: Archives of Toxicology, 91:2837, 2016 : PubMed

            

    Title: Freshwater Planarians as an Alternative Animal Model for Neurotoxicology
    Hagstrom D, Cochet-Escartin O, Zhang S, Khuu C, Collins EM
    Ref: Toxicol Sci, 147:270, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer