Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: fusnn-FN0616

Fusobacterium nucleatum hypothetical protein fn0616 Alpha/beta superfamily hydrolase

Comment
Other strains:Fusobacterium nucleatum (strains: subsp. nucleatum ATCC 23726 subsp. polymorphum F0401; subsp. animalis ATCC 51191)


Relationship
Family|Tannase_Bact
Block| H
Position in NCBI Life Tree|Fusobacterium nucleatum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Fusobacteria: N E > Fusobacteriia: N E > Fusobacteriales: N E > Fusobacteriaceae: N E > Fusobacterium: N E > Fusobacterium nucleatum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
6YQ4: Crystal structure of Fusobacterium nucleatum tannase
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: AE009951, ADVK01000010, ADDB01000007
3 UniProt : Q8RFS1, D5RAM4, F9EMM1
1 Structure : 6YQ4
3 UniProt : Q8RFS1, D5RAM4, F9EMM1
3 Interpro : Q8RFS1, D5RAM4, F9EMM1
3 Prodom : Q8RFS1, D5RAM4, F9EMM1
3 Pfam : Q8RFS1, D5RAM4, F9EMM1
3 PIRSF : Q8RFS1, D5RAM4, F9EMM1
3 SUPERFAM : Q8RFS1, D5RAM4, F9EMM1
Sequence
Graphical view for this peptide sequence: fusnn-FN0616
Colored MSA for Tannase_Bact (raw)
MVKNDYDLKFNPDKYISKEIKINGKKIKYRAYENIIYIKNPIDKDYQNMN
IYIPEEYFNNLSIGSYNSNNAPIFFPNTVGGYMPGKADTVGLGRDGKANS
LTYALSKGYVVAAPGARGRTLTDDKGNYIGKAPAAIVDLKAAVRYLYLND
EVMPGDANKIISNGTSAGGALSALLGASGNSQDYLPYLKEIGAAETRDDI
FAVSAYCPITNLENADSAYEWMYNGVNSYSRMEFTRNTSAQEYNDRSLTR
STVQGNLTNDEINISNKLKTLFPIYLNSLKLTDDGGNLLTLDKSGNGSFK
TYLSIIIRNSANRALREGKDISQFKKAFTIENNKVVAVNLDVYTHIGDRM
KSPPAFDSLDASSGENNLFGDKKSDSKHFTKFSFDINNKAAIDYFRNGKF
NDKNNKISIPKMADKNIIKMMNPMYYIDSNTSTKYWRIRHGAIDKDTSLA
IPAILALKLKNSGKIVNFAAPWGQGHGGDYDLEELFNWIDNVVKK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVKNDYDLKFNPDKYISKEIKINGKKIKYRAYENIIYIKNPIDKDYQNMN
IYIPEEYFNNLSIGSYNSNNAPIFFPNTVGGYMPGKADTVGLGRDGKANS
LTYALSKGYVVAAPGARGRTLTDDKGNYIGKAPAAIVDLKAAVRYLYLND
EVMPGDANKIISNGTSAGGALSALLGASGNSQDYLPYLKEIGAAETRDDI
FAVSAYCPITNLENADSAYEWMYNGVNSYSRMEFTRNTSAQEYNDRSLTR
STVQGNLTNDEINISNKLKTLFPIYLNSLKLTDDGGNLLTLDKSGNGSFK
TYLSIIIRNSANRALREGKDISQFKKAFTIENNKVVAVNLDVYTHIGDRM
KSPPAFDSLDASSGENNLFGDKKSDSKHFTKFSFDINNKAAIDYFRNGKF
NDKNNKISIPKMADKNIIKMMNPMYYIDSNTSTKYWRIRHGAIDKDTSLA
IPAILALKLKNSGKIVNFAAPWGQGHGGDYDLEELFNWIDNVVKK


References
    Title: A structurally unique Fusobacterium nucleatum tannase provides detoxicant activity against gallotannins and pathogen resistance
    Mancheno JM, Atondo E, Tomas-Cortazar J, Luis Lavin J, Plaza-Vinuesa L, Martin-Ruiz I, Barriales D, Palacios A, Daniel Navo C and Rodriguez H <14 more author(s)>
    Ref: Microb Biotechnol, :, 2020 : PubMed

            

    Title: Genome sequence and analysis of the oral bacterium Fusobacterium nucleatum strain ATCC 25586
    Kapatral V, Anderson I, Ivanova N, Reznik G, Los T, Lykidis A, Bhattacharyya A, Bartman A, Gardner W and Overbeek R <15 more author(s)>
    Ref: Journal of Bacteriology, 184:2005, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer