Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: fusnv-q7p2e5

Fusobacterium nucleatum, Fusobacterium sp., methyltransferase (EC 2.1.1.-)

Comment
Other strains: Fusobacterium nucleatum (subsp. vincentii ATCC 49256; subsp. nucleatum ATCC 23726), Fusobacterium sp. (strains: 4_1_13; 3_1_27;_1_36A2; 7_1) only n-term Pfam A Abhydrolase_6 28 264 rest Pfam A Methyltransf_20


Relationship
Family|Monoglyceridelipase_lysophospholip
Block| X
Position in NCBI Life Tree|Fusobacterium nucleatum subsp. vincentii ATCC 49256
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Fusobacteria: N E > Fusobacteriia: N E > Fusobacteriales: N E > Fusobacteriaceae: N E > Fusobacterium: N E > Fusobacterium nucleatum: N E > Fusobacterium nucleatum subsp. vincentii: N E > Fusobacterium nucleatum subsp. vincentii ATCC 49256: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: AABF01000121, AE010636, ADVK01000021
3 UniProt : Q7P2E5, C7XNU2, D5RBR0
>3 UniProt links 1 more: Q7P2E5, C7XNU2, Q8R624
>3 Interpro links 1 more: Q7P2E5, C7XNU2, Q8R624
>3 Pfam links 1 more: Q7P2E5, C7XNU2, Q8R624
>3 PIRSF links 1 more: Q7P2E5, C7XNU2, Q8R624
>3 SUPERFAM links 1 more: Q7P2E5, C7XNU2, Q8R624
Sequence
Graphical view for this peptide sequence: fusnv-q7p2e5
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
MGGDMENLFFNTFDGNKIFYRVWNFEKNKKTLIIIHRGHEHSERLSELTQ
DEKFLKYNIFAYDLRGHGYTEAKTSPNAMDYVRDLDFFVKHIKSEYQIKE
EDIFIVANSIGGVILSAYVHDFAPNIAGIALLAPAFEIKLYIPFAKQLIT
LLTKIKKDAKVMSYVKAKVLTHDVEEQNKYNNDKLINKEINAKLLIDLAN
MGKRLVEDSMAIELPTIIFSAEKDYVVKNSAQKKFFLNLSSKKREFIELE
NFYHGIIFEKERQKVYKMLDDFIQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGGDMENLFFNTFDGNKIFYRVWNFEKNKKTLIIIHRGHEHSERLSELTQ
DEKFLKYNIFAYDLRGHGYTEAKTSPNAMDYVRDLDFFVKHIKSEYQIKE
EDIFIVANSIGGVILSAYVHDFAPNIAGIALLAPAFEIKLYIPFAKQLIT
LLTKIKKDAKVMSYVKAKVLTHDVEEQNKYNNDKLINKEINAKLLIDLAN
MGKRLVEDSMAIELPTIIFSAEKDYVVKNSAQKKFFLNLSSKKREFIELE
NFYHGIIFEKERQKVYKMLDDFIQ


Reference
    Title: Genome sequence and analysis of the oral bacterium Fusobacterium nucleatum strain ATCC 25586
    Kapatral V, Anderson I, Ivanova N, Reznik G, Los T, Lykidis A, Bhattacharyya A, Bartman A, Gardner W and Overbeek R <15 more author(s)>
    Ref: Journal of Bacteriology, 184:2005, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer