Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: fuspc-k3u8z2

Fusarium pseudograminearum (strain CS3096) (Wheat and barley crown-rot fungus) Uncharacterized protein

Relationship
Family|Fungal_carboxylesterase_lipase
Block| C
Position in NCBI Life Tree|Fusarium pseudograminearum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Hypocreales: N E > Nectriaceae: N E > Fusarium: N E > Fusarium sambucinum species complex: N E > Fusarium pseudograminearum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AFNW01000621
1 UniProt : K3U8Z2
1 UniProt : K3U8Z2
1 Interpro : K3U8Z2
1 Pfam : K3U8Z2
1 PIRSF : K3U8Z2
1 SUPERFAM : K3U8Z2
Sequence
Graphical view for this peptide sequence: fuspc-k3u8z2
Colored MSA for Fungal_carboxylesterase_lipase (raw)
MKLSSLIETCFALSWSQETLAATQTKIFAPTVTVKNGTYAGVYNKQYDQD
YFLGLPFAQASSHNNPPERFSVAQGLNTSWDGVRNVTELPVHCYGYGSDQ
DGYKQSEDCLYLNVIRPANLKTTANIPVAVWVHGGGLFQGGASDLRYNLS
FIVEQSVALGTPIIGVSFNYRLSAFGFIVGKEVLKEGATNIGFRDQRLAL
HWVQENIKAFGGDPDKVTIFGESSGAESIAAQVLAYNGRDDGLFRGAIGQ
SGFGAPLPRYRGGYNATEAMQATYDRFVGKVPSCADLKGSDKSLPCLRKA
PFDEINSAIRAINTGLDWSPVLDGDFIADYNTNQFENGKFVKVPLLIGAN
TDEGTAFGRNRTPDGGNVNTDEDMRDAIGAGIPPHAEDTAGQTAEELTDE
LMELYPNDQRVGIPSLESWPHIIKPNDSYAEVHGAQYRRSCALFGDLIIQ
YQRRRANKFWAKHGIPNYAYRFNIKPNGQPEYAGVTHFQEVAFVLYNILG
DGYNRKPFGGEGSYPENAKAMSKTISTAWINFFNTLDPNGKTGEEIFSGK
EWPAYDLSDGPDGEGIVFNINGSDIEVDDWRSGGMEWMAEHALDVFGN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKLSSLIETCFALSWSQETLAATQTKIFAPTVTVKNGTYAGVYNKQYDQD
YFLGLPFAQASSHNNPPERFSVAQGLNTSWDGVRNVTELPVHCYGYGSDQ
DGYKQSEDCLYLNVIRPANLKTTANIPVAVWVHGGGLFQGGASDLRYNLS
FIVEQSVALGTPIIGVSFNYRLSAFGFIVGKEVLKEGATNIGFRDQRLAL
HWVQENIKAFGGDPDKVTIFGESSGAESIAAQVLAYNGRDDGLFRGAIGQ
SGFGAPLPRYRGGYNATEAMQATYDRFVGKVPSCADLKGSDKSLPCLRKA
PFDEINSAIRAINTGLDWSPVLDGDFIADYNTNQFENGKFVKVPLLIGAN
TDEGTAFGRNRTPDGGNVNTDEDMRDAIGAGIPPHAEDTAGQTAEELTDE
LMELYPNDQRVGIPSLESWPHIIKPNDSYAEVHGAQYRRSCALFGDLIIQ
YQRRRANKFWAKHGIPNYAYRFNIKPNGQPEYAGVTHFQEVAFVLYNILG
DGYNRKPFGGEGSYPENAKAMSKTISTAWINFFNTLDPNGKTGEEIFSGK
EWPAYDLSDGPDGEGIVFNINGSDIEVDDWRSGGMEWMAEHALDVFGN


Reference
    Title: Comparative pathogenomics reveals horizontally acquired novel virulence genes in fungi infecting cereal hosts
    Gardiner DM, McDonald MC, Covarelli L, Solomon PS, Rusu AG, Marshall M, Kazan K, Chakraborty S, McDonald BA, Manners JM
    Ref: PLoS Pathog, 8:e1002952, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer