gibze-i1rsg2

Gibberella zeae (Wheat head blight fungus) (Fusarium graminearum) Fusarium pseudograminearum (Wheat and barley crown-rot fungus) Uncharacterized protein

Comment

"Other strains: Gibberella zeae (Wheat head blight fungus) (Fusarium graminearum) (strain PH-1 \/ ATCC MYA-4620 \/ FGSC 9075 \/ NRRL 31084) Fusarium pseudograminearum (strain CS3096) (Wheat and barley crown-rot fungus)"

Relationship

Family : Fungal_carboxylesterase_lipase

Block : C

Position in NCBI Life Tree : Gibberella zeae

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MTAAPKRQDPISEEDSVHIPNETTAPTKKPSRKKWFIIGG
IVILVVLVLS LTLGLYYGLKKKEHDVVNDSAAKSNADPP
QPSNVPDKDSNDSDDNNNDND NNNDKGNDNGNSKGESSD
ESTKKKEGPFVDLGYSQYEGNVLSSDIYEYLG IRYAKST
SSDMRWKAPVAPDSTTEVLKAQKYAPFCPGVNDRLGSTID
EDC LFVNVWAPANVTSDSKLPVMVFFQSGGYIRNASPYI
NGSGLVTASNNSII YVNFNYRVGMFGFLAGKEIKEDGDL
NAGLLDQRFLLKWVQEHIQEFGGDS ERVILHGQSAGAGS
VALQLAAYGGKDEGLFAGAIAESVFMPGLPEPNDIQ YQF
DRVVNATNCSEEDDTLACLRGMDSSALQAQNIKAPFDGRD
YRSYFYW APTTDGDMFPDFPSELYKKGNFAKVPLLTGSC
TNEGSNYAVNAGSSAQFI RYMQNEYPYLTTKDTETILEL
YPKEPALPKHDIWFPSASRAYAEVTFVCP TNNMLDAYAE
HADPETLWSYRYNVQITEFIEDGLGVPHVANAPAVFGPDY
TAAKAGPSYRTYNAPMIPVVQSYWISFVHNLDPNKDRYE
GTPKWENWGDD QRRLVFELNNNTMETVDQGQKDRCQAWL
DMSDSTKQ

References

Title : Genome Sequence of Fusarium graminearum Isolate CS3005 - Gardiner_2014_Genome.Announc_2_e00227
Author(s) : Gardiner DM , Stiller J , Kazan K
Ref : Genome Announc , 2 : , 2014
Abstract : Gardiner_2014_Genome.Announc_2_e00227
ESTHER : Gardiner_2014_Genome.Announc_2_e00227
PubMedSearch : Gardiner_2014_Genome.Announc_2_e00227
PubMedID: 24744326
Gene_locus related to this paper: fusof-f9fxz4 , gibze-a8w610 , gibze-b1pdn0 , gibze-i1r9e6 , gibze-i1rda9 , gibze-i1rdk7 , gibze-i1rec8 , gibze-i1rgs0 , gibze-i1rh52 , gibze-i1rig9 , gibze-i1rip5 , gibze-i1rsg2 , gibze-i1rv36 , gibze-i1rxm5 , gibze-i1rxp8 , gibze-i1rxv5 , gibze-i1s3j9 , gibze-i1s6l7 , gibze-i1s8i8 , gibze-i1s9x4 , fuspc-k3vzd3 , gibza-a0a016pg72 , gibza-a0a016pda4 , gibza-a0a016pl96

Title : Comparative pathogenomics reveals horizontally acquired novel virulence genes in fungi infecting cereal hosts - Gardiner_2012_PLoS.Pathog_8_e1002952
Author(s) : Gardiner DM , McDonald MC , Covarelli L , Solomon PS , Rusu AG , Marshall M , Kazan K , Chakraborty S , McDonald BA , Manners JM
Ref : PLoS Pathog , 8 :e1002952 , 2012
Abstract : Gardiner_2012_PLoS.Pathog_8_e1002952
ESTHER : Gardiner_2012_PLoS.Pathog_8_e1002952
PubMedSearch : Gardiner_2012_PLoS.Pathog_8_e1002952
PubMedID: 23028337
Gene_locus related to this paper: gibze-a8w610 , gibze-i1rda9 , gibze-i1rdk7 , gibze-i1rec8 , gibze-i1rgs0 , gibze-i1rgy0 , gibze-i1rh52 , gibze-i1rig9 , gibze-i1rip5 , gibze-i1rpg6 , gibze-i1rsg2 , gibze-i1rv36 , gibze-i1rxm5 , gibze-i1rxp8 , gibze-i1rxv5 , gibze-i1s3j9 , gibze-i1s8i8 , gibze-i1s9x4 , gibze-q4huy1 , fuspc-k3u8z2 , fuspc-k3vzd3 , fuspc-k3w1u7 , gibza-a0a016pl96 , fuspc-k3ufi3 , gibze-i1rkc4 , fuspc-fdb26 , fuspc-w4935

Title : Comparative genomics reveals mobile pathogenicity chromosomes in Fusarium - Ma_2010_Nature_464_367
Author(s) : Ma LJ , van der Does HC , Borkovich KA , Coleman JJ , Daboussi MJ , Di Pietro A , Dufresne M , Freitag M , Grabherr M , Henrissat B , Houterman PM , Kang S , Shim WB , Woloshuk C , Xie X , Xu JR , Antoniw J , Baker SE , Bluhm BH , Breakspear A , Brown DW , Butchko RA , Chapman S , Coulson R , Coutinho PM , Danchin EG , Diener A , Gale LR , Gardiner DM , Goff S , Hammond-Kosack KE , Hilburn K , Hua-Van A , Jonkers W , Kazan K , Kodira CD , Koehrsen M , Kumar L , Lee YH , Li L , Manners JM , Miranda-Saavedra D , Mukherjee M , Park G , Park J , Park SY , Proctor RH , Regev A , Ruiz-Roldan MC , Sain D , Sakthikumar S , Sykes S , Schwartz DC , Turgeon BG , Wapinski I , Yoder O , Young S , Zeng Q , Zhou S , Galagan J , Cuomo CA , Kistler HC , Rep M
Ref : Nature , 464 :367 , 2010
Abstract : Ma_2010_Nature_464_367
ESTHER : Ma_2010_Nature_464_367
PubMedSearch : Ma_2010_Nature_464_367
PubMedID: 20237561
Gene_locus related to this paper: fusox-a0a1d3s5h0 , gibf5-fus2 , fusof-f9f2k2 , fusof-f9f3l6 , fusof-f9f6t8 , fusof-f9f6v2 , fusof-f9f132 , fusof-f9f781 , fusof-f9fd72 , fusof-f9fd90 , fusof-f9fem0 , fusof-f9fhk2 , fusof-f9fj19 , fusof-f9fj20 , fusof-f9fki8 , fusof-f9fmx2 , fusof-f9fnt4 , fusof-f9fpy4 , fusof-f9fvs6 , fusof-f9fwu0 , fusof-f9fxz4 , fusof-f9fzy5 , fusof-f9g2a2 , fusof-f9g3b1 , fusof-f9g5h7 , fusof-f9g6e6 , fusof-f9g6y7 , fusof-f9g7b0 , fusof-f9g797 , fusof-f9g972 , fusof-f9ga50 , fusof-f9gck4 , fusof-f9gd15 , gibze-a8w610 , gibze-b1pdn0 , gibze-i1r9e6 , gibze-i1rda9 , gibze-i1rdk7 , gibze-i1rec8 , gibze-i1rgs0 , gibze-i1rgy0 , gibze-i1rh52 , gibze-i1rhi8 , gibze-i1rig9 , gibze-i1rip5 , gibze-i1rpg6 , gibze-i1rsg2 , gibze-i1rv36 , gibze-i1rxm5 , gibze-i1rxp8 , gibze-i1rxv5 , gibze-i1s1u3 , gibze-i1s3j9 , gibze-i1s6l7 , gibze-i1s8i8 , gibze-i1s9x4 , gibze-q4huy1 , gibze-i1rg17 , fuso4-j9mvr9 , fuso4-j9ngs6 , fuso4-j9niq8 , fuso4-j9nqm2 , gibze-i1rb76 , gibze-i1s1m7 , gibze-i1s3z6 , gibze-i1rd78 , gibze-i1rgl9 , gibze-i1rjp7 , gibze-i1s1q6 , gibze-i1ri35 , gibze-i1rf76 , gibze-i1rhp3 , fusc1-n4uj11 , fusc4-n1s9p6 , gibf5-s0dqr2 , gibm7-w7n1b5 , fusof-f9g6q0 , gibm7-w7n497 , fusox-x0bme4 , gibm7-w7mcf8 , gibm7-w7mak5 , fusox-x0a2c5 , gibm7-w7mum7 , fusox-w9iyc7 , gibm7-w7maw6 , gibm7-w7msi0 , gibm7-w7luf0 , gibm7-w7msa3 , gibm7-w7mna8 , gibm7-w7n8b7 , gibm7-w7n564 , fusox-w9jpi0 , gibm7-w7ngc3 , gibm7-w7m4v6 , gibm7-w7m4v2 , gibm7-w7lt61 , gibm7-w7mly6 , gibm7-w7ncn3 , fusox-w9ibd7 , fusof-f9fnm6 , gibm7-w7n526 , gibza-a0a016pda4 , gibza-a0a016pl96 , gibm7-w7muq1 , fusof-f9gfd3 , gibm7-w7mt52 , gibze-i1rjb5 , gibf5-s0ehu3 , fusox-w9hvf0 , gibze-i1rkc4 , gibm7-w7mv30 , gibze-a0a1c3ylb1 , fuso4-a0a0c4diy4 , gibm7-w7n4n0 , gibze-gra11 , gibze-fsl2 , gibf5-fub4 , gibf5-fub5 , gibf5-fus5 , gibm7-dlh1

Title : The Fusarium graminearum genome reveals a link between localized polymorphism and pathogen specialization - Cuomo_2007_Science_317_1400
Author(s) : Cuomo CA , Guldener U , Xu JR , Trail F , Turgeon BG , Di Pietro A , Walton JD , Ma LJ , Baker SE , Rep M , Adam G , Antoniw J , Baldwin T , Calvo S , Chang YL , Decaprio D , Gale LR , Gnerre S , Goswami RS , Hammond-Kosack K , Harris LJ , Hilburn K , Kennell JC , Kroken S , Magnuson JK , Mannhaupt G , Mauceli E , Mewes HW , Mitterbauer R , Muehlbauer G , Munsterkotter M , Nelson D , O'Donnell K , Ouellet T , Qi W , Quesneville H , Roncero MI , Seong KY , Tetko IV , Urban M , Waalwijk C , Ward TJ , Yao J , Birren BW , Kistler HC
Ref : Science , 317 :1400 , 2007
Abstract : Cuomo_2007_Science_317_1400
ESTHER : Cuomo_2007_Science_317_1400
PubMedSearch : Cuomo_2007_Science_317_1400
PubMedID: 17823352
Gene_locus related to this paper: fusof-f9fxz4 , gibze-a8w610 , gibze-b1pdn0 , gibze-i1r9e6 , gibze-i1rda9 , gibze-i1rdk7 , gibze-i1rec8 , gibze-i1rgs0 , gibze-i1rgy0 , gibze-i1rh52 , gibze-i1rhi8 , gibze-i1rig9 , gibze-i1rip5 , gibze-i1rpg6 , gibze-i1rsg2 , gibze-i1rv36 , gibze-i1rxm5 , gibze-i1rxp8 , gibze-i1rxv5 , gibze-i1s1u3 , gibze-i1s3j9 , gibze-i1s6l7 , gibze-i1s8i8 , gibze-i1s9x4 , gibze-ppme1 , gibze-q4huy1 , gibze-i1rg17 , gibze-i1rb76 , gibze-i1s1m7 , gibze-i1s3z6 , gibze-i1rd78 , gibze-i1rgl9 , gibze-i1rjp7 , gibze-i1s1q6 , gibze-i1ri35 , gibze-i1rf76 , gibze-i1rhp3 , gibza-a0a016pda4 , gibza-a0a016pl96 , gibze-i1rjb5 , gibze-i1rkc4 , gibze-a0a1c3ylb1 , gibze-gra11 , gibze-fsl2