Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: gorpv-h6n352

Gordonia polyisoprenivorans (strain DSM 44266 / VH2) Cutinase

Relationship
Family|Cutinase
Block| X
Position in NCBI Life Tree|Gordonia polyisoprenivorans
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Gordoniaceae: N E > Gordonia: N E > Gordonia polyisoprenivorans: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP003119
1 UniProt : H6N352
1 UniProt : H6N352
1 Interpro : H6N352
1 Pfam : H6N352
1 PIRSF : H6N352
1 SUPERFAM : H6N352
Sequence
Graphical view for this peptide sequence: gorpv-h6n352
Colored MSA for Cutinase (raw)
MKRPLLILFGFTVLAAGLLASPAPRAAAAPPCADVEVVFARGTVETAPPV
GVTGLSFEQALRNQLPGKSVNVYGVNYPAGSNFDNRMAFVEGVVKGVNDT
QRRIKYLAAQCPGSHIVVGGYSQGAVVASYALSNKIQIDPQYRQYQDRVP
QPLADNAASHVTAAILFAPPSSNWIKQVGAPPMNVGPLYEGKTKRYCIAG
DVVCDGAPVGQPNGLHVLYAVNGMTVDAAQYVKARL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKRPLLILFGFTVLAAGLLASPAPRAAAAPPCADVEVVFARGTVETAPPV
GVTGLSFEQALRNQLPGKSVNVYGVNYPAGSNFDNRMAFVEGVVKGVNDT
QRRIKYLAAQCPGSHIVVGGYSQGAVVASYALSNKIQIDPQYRQYQDRVP
QPLADNAASHVTAAILFAPPSSNWIKQVGAPPMNVGPLYEGKTKRYCIAG
DVVCDGAPVGQPNGLHVLYAVNGMTVDAAQYVKARL


Reference
    Title: Involvement of two latex-clearing proteins during rubber degradation and insights into the subsequent degradation pathway revealed by the genome sequence of Gordonia polyisoprenivorans strain VH2
    Hiessl S, Schuldes J, Thurmer A, Halbsguth T, Broker D, Angelov A, Liebl W, Daniel R, Steinbuchel A
    Ref: Applied Environmental Microbiology, 78:2874, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer