Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: human-ACOT4

Homo sapiens (Human) Q8N9L9 Acyl-coenzyme A thioesterase 4, inducible (EC 3.1.2.2)

Comment
The mouse ACOT gene cluster comprises six genes with localizations in cytosol (ACOT1), mitochondria (ACOT2), and peroxisomes (ACOT3-6). The corresponding human gene cluster contains only three genes (ACOT1, ACOT2, and ACOT4) coding for full-length thioesterase proteins only ACOT4 is peroxisomal


Relationship
Family|Acyl-CoA_Thioesterase
Block| X
Position in NCBI Life Tree|Homo sapiens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E


Molecular evidence
Database
No mutation
1 structure:
3K2I: Human Acyl-coenzyme A thioesterase 4
No kinetic





No Substrate
No inhibitor
>3 Genbank links 4 more: AK094223, BX248047, BC090945
1 UniProt : Q8N9L9
1 Structure : 3K2I
1 UniProt : Q8N9L9
1 Interpro : Q8N9L9
1 Prodom : Q8N9L9
1 Pfam : Q8N9L9
1 PIRSF : Q8N9L9
1 SUPERFAM : Q8N9L9
1 EntrezGene : 122970
1 SNP : 122970
1 UniGene : 49433
1 HUGO HGNC : 19748
1 OMIM : 614314
1 Ensembl : ENSG00000177465
Sequence
Graphical view for this peptide sequence: human-ACOT4
Colored MSA for Acyl-CoA_Thioesterase (raw)
MSATLILEPPGRCCWNEPVRIAVRGLAPEQRVTLRASLRDEKGALFRAHA
RYCADARGELDLERAPALGGSFAGLEPMGLLWALEPEKPFWRFLKRDVQI
PFVVELEVLDGHDPEPGRLLCQAQHERHFPPPGVRRQSVRAGRVRATLFL
PPGPGPFPGIIDIFGIGGGLLEYRASLLAGHGFATLDLQSYNFEDLPNNM
DNISLEYFEEAVCYMLQHPQVKGPGIGLLGISLGADICLSMASFLKNVSA
TVSINGSGISGNTAINYKHSSIPPLGYDLRRIKVAFSGLVDIVDIRNALV
GGYKNPSMIPIEKAQGPILLIVGQDDHNWRSELYAQTVSERLQAHGKEKP
QIICYPGTGHYIEPPYFPLCPASLHRLLNKHVIWGGEPRAHSKAQEDAWK
QILAFFCKHLGGTQKTAVPKL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSATLILEPPGRCCWNEPVRIAVRGLAPEQRVTLRASLRDEKGALFRAHA
RYCADARGELDLERAPALGGSFAGLEPMGLLWALEPEKPFWRFLKRDVQI
PFVVELEVLDGHDPEPGRLLCQAQHERHFPPPGVRRQSVRAGRVRATLFL
PPGPGPFPGIIDIFGIGGGLLEYRASLLAGHGFATLDLQSYNFEDLPNNM
DNISLEYFEEAVCYMLQHPQVKGPGIGLLGISLGADICLSMASFLKNVSA
TVSINGSGISGNTAINYKHSSIPPLGYDLRRIKVAFSGLVDIVDIRNALV
GGYKNPSMIPIEKAQGPILLIVGQDDHNWRSELYAQTVSERLQAHGKEKP
QIICYPGTGHYIEPPYFPLCPASLHRLLNKHVIWGGEPRAHSKAQEDAWK
QILAFFCKHLGGTQKTAVPKL


Reference
    Title: Analysis of the mouse and human acyl-CoA thioesterase (ACOT) gene clusters shows that convergent, functional evolution results in a reduced number of human peroxisomal ACOTs
    Hunt MC, Rautanen A, Westin MA, Svensson LT, Alexson SE
    Ref: FASEB Journal, 20:1855, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer