human-ACOT1

Homo sapiens (Human) Inducible cytosolic acyl-coenzyme A thioester hydrolase Long chain Acyl-CoA hydrolase) (cte-i) (cte-ib)

Comment

"The mouse ACOT gene cluster comprises six genes with localizations in cytosol (ACOT1), mitochondria (ACOT2), and peroxisomes (ACOT3-6). The corresponding human gene cluster contains only three genes (ACOT1, ACOT2, and ACOT4) coding for full-length thioesterase proteins only ACOT4 is peroxisomal"

Relationship

Family : Acyl-CoA_Thioesterase

Block : X

Position in NCBI Life Tree : Homo sapiens

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

Sequence

Peptide

MAATLILEPAGRCCWDEPVRIAVRGLAPEQPVTLRASLRD
EKGALFQAHA RYRADTLGELDLERAPALGGSFAGLEPMG
LLWALEPEKPLVRLVKRDVRT PLAVELEVLDGHDPDPGR
LLCRVRHERYFLPPGVRREPVRAGRVRGTLFL PPEPGPF
PGIVDMFGTGGGLLEYRASLLAGKGFAVMALAYYNYEDLP
KTM ETLHLEYFEEAVNYLLSHPEVKGPGVGLLGISKGGE
LCLSMASFLKGITA AVVINGSVANVGGTLRYKGETLPPV
GVNRNRIKVTKDGYADIVDVLNSPL EGPDQKSFIPVERA
ESTFLFLVGQDDHNWKSEFYANEACKRLQAHGRRKP QII
CYPETGHYIEPPYFPLCRASLHALVGSPIIWGGEPRAHAM
AQVDAWK QLQTFFHKHLGGHEGTIPSKV

References

Title : Remodeling natural products: chemistry and serine hydrolase activity of a rocaglate-derived beta-lactone - Lajkiewicz_2014_J.Am.Chem.Soc_136_2659
Author(s) : Lajkiewicz NJ , Cognetta AB, 3rd , Niphakis MJ , Cravatt BF , Porco JA, Jr.
Ref : Journal of the American Chemical Society , 136 :2659 , 2014
Abstract : Lajkiewicz_2014_J.Am.Chem.Soc_136_2659
ESTHER : Lajkiewicz_2014_J.Am.Chem.Soc_136_2659
PubMedSearch : Lajkiewicz_2014_J.Am.Chem.Soc_136_2659
PubMedID: 24447064
Gene_locus related to this paper: human-ABHD10 , human-ACOT1 , human-ACOT2 , human-CTSA , human-SCPEP1 , mouse-abhda

Title : Analysis of the mouse and human acyl-CoA thioesterase (ACOT) gene clusters shows that convergent, functional evolution results in a reduced number of human peroxisomal ACOTs - Hunt_2006_FASEB.J_20_1855
Author(s) : Hunt MC , Rautanen A , Westin MA , Svensson LT , Alexson SE
Ref : FASEB Journal , 20 :1855 , 2006
Abstract : Hunt_2006_FASEB.J_20_1855
ESTHER : Hunt_2006_FASEB.J_20_1855
PubMedSearch : Hunt_2006_FASEB.J_20_1855
PubMedID: 16940157
Gene_locus related to this paper: human-ACOT1 , human-ACOT2 , human-ACOT4 , human-ACOT6 , mouse-acot1 , mouse-acot2 , mouse-acot3 , mouse-acot4 , mouse-acot5 , mouse-ACOT6

Title : Complete sequencing and characterization of 21,243 full-length human cDNAs - Ota_2004_Nat.Genet_36_40
Author(s) : Ota T , Suzuki Y , Nishikawa T , Otsuki T , Sugiyama T , Irie R , Wakamatsu A , Hayashi K , Sato H , Nagai K , Kimura K , Makita H , Sekine M , Obayashi M , Nishi T , Shibahara T , Tanaka T , Ishii S , Yamamoto J , Saito K , Kawai Y , Isono Y , Nakamura Y , Nagahari K , Murakami K , Yasuda T , Iwayanagi T , Wagatsuma M , Shiratori A , Sudo H , Hosoiri T , Kaku Y , Kodaira H , Kondo H , Sugawara M , Takahashi M , Kanda K , Yokoi T , Furuya T , Kikkawa E , Omura Y , Abe K , Kamihara K , Katsuta N , Sato K , Tanikawa M , Yamazaki M , Ninomiya K , Ishibashi T , Yamashita H , Murakawa K , Fujimori K , Tanai H , Kimata M , Watanabe M , Hiraoka S , Chiba Y , Ishida S , Ono Y , Takiguchi S , Watanabe S , Yosida M , Hotuta T , Kusano J , Kanehori K , Takahashi-Fujii A , Hara H , Tanase TO , Nomura Y , Togiya S , Komai F , Hara R , Takeuchi K , Arita M , Imose N , Musashino K , Yuuki H , Oshima A , Sasaki N , Aotsuka S , Yoshikawa Y , Matsunawa H , Ichihara T , Shiohata N , Sano S , Moriya S , Momiyama H , Satoh N , Takami S , Terashima Y , Suzuki O , Nakagawa S , Senoh A , Mizoguchi H , Goto Y , Shimizu F , Wakebe H , Hishigaki H , Watanabe T , Sugiyama A , Takemoto M , Kawakami B , Watanabe K , Kumagai A , Itakura S , Fukuzumi Y , Fujimori Y , Komiyama M , Tashiro H , Tanigami A , Fujiwara T , Ono T , Yamada K , Fujii Y , Ozaki K , Hirao M , Ohmori Y , Kawabata A , Hikiji T , Kobatake N , Inagaki H , Ikema Y , Okamoto S , Okitani R , Kawakami T , Noguchi S , Itoh T , Shigeta K , Senba T , Matsumura K , Nakajima Y , Mizuno T , Morinaga M , Sasaki M , Togashi T , Oyama M , Hata H , Komatsu T , Mizushima-Sugano J , Satoh T , Shirai Y , Takahashi Y , Nakagawa K , Okumura K , Nagase T , Nomura N , Kikuchi H , Masuho Y , Yamashita R , Nakai K , Yada T , Ohara O , Isogai T , Sugano S
Ref : Nat Genet , 36 :40 , 2004
Abstract : Ota_2004_Nat.Genet_36_40
ESTHER : Ota_2004_Nat.Genet_36_40
PubMedSearch : Ota_2004_Nat.Genet_36_40
PubMedID: 14702039
Gene_locus related to this paper: human-ABHD1 , human-ABHD4 , human-ABHD12 , human-ABHD16A , human-ACOT1 , human-LDAH , human-ABHD18 , human-CES1 , human-CES4A , human-CES5A , human-CPVL , human-DAGLB , human-EPHX2 , human-KANSL3 , human-LIPA , human-LPL , human-MEST , human-NDRG1 , human-NLGN1 , human-NLGN4X , human-PRCP , human-PRSS16 , human-SERAC1 , human-TMEM53