Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: human-LIPJ

Homo sapiens (Human) Lipase member J lipase-like, ab-hydrolase domain containing 1

Relationship
Family|Acidic_Lipase
Block| X
Position in NCBI Life Tree|Homo sapiens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AL139406
1 UniProt : Q5W064
1 UniProt : Q5W064
1 Interpro : Q5W064
1 Prodom : Q5W064
1 Pfam : Q5W064
1 PIRSF : Q5W064
1 SUPERFAM : Q5W064
1 EntrezGene : 142910
1 SNP : 142910
1 UniGene : 440959
1 HUGO HGNC : 21773
1 OMIM : 613921
1 Ensembl : ENSG00000204022
Sequence
Graphical view for this peptide sequence: human-LIPJ
Colored MSA for Acidic_Lipase (raw)
MNISQIISYWGYPDEEYDIVTEDGYILGLYRIPYWRTDNNKNLAQRVVVY
LQHGLLTSASSWISNLPNNSLGFILADAGYDVWMGNSRGNTWSRKHLYLE
TSSKEFWAFSFDEMAKYDLPASIDFTVKQTRQEEIFYVGHSQGTTIGFIT
FSTISKIAERIKIFFALAPVFSTKYLKSPLIRMTYKWKSIVMAFSGNKDF
LPKTSFKKFIGSKLCPLQIFDKICLNILFMMFGYDPKNLNMSRLDVYFSH
NPAGTSVQNMLHWSQLLNSTHLKAYDWGSPDLNLVHYNQTTSPLYNMTNM
NVATAIWNGKSDLLADPEDVNILHSEITNHIYYKTISYYNHIDSLFGLDV
YDQVYHEIIDIIQDNL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNISQIISYWGYPDEEYDIVTEDGYILGLYRIPYWRTDNNKNLAQRVVVY
LQHGLLTSASSWISNLPNNSLGFILADAGYDVWMGNSRGNTWSRKHLYLE
TSSKEFWAFSFDEMAKYDLPASIDFTVKQTRQEEIFYVGHSQGTTIGFIT
FSTISKIAERIKIFFALAPVFSTKYLKSPLIRMTYKWKSIVMAFSGNKDF
LPKTSFKKFIGSKLCPLQIFDKICLNILFMMFGYDPKNLNMSRLDVYFSH
NPAGTSVQNMLHWSQLLNSTHLKAYDWGSPDLNLVHYNQTTSPLYNMTNM
NVATAIWNGKSDLLADPEDVNILHSEITNHIYYKTISYYNHIDSLFGLDV
YDQVYHEIIDIIQDNL


References
    Title: Determination of Genetic Effects of LIPK and LIPJ Genes on Milk Fatty Acids in Dairy Cattle
    Shi L, Han B, Liu L, Lv X, Ma Z, Li C, Xu L, Li Y, Zhao F and Sun D <1 more author(s)>
    Ref: Genes (Basel), 10:, 2019 : PubMed

            

    Title: Comparative studies of mammalian acid lipases: Evidence for a new gene family in mouse and rat (Lipo)
    Holmes RS, Cox LA, Vandeberg JL
    Ref: Comparative Biochemistry & Physiology Part D Genomics Proteomics, 5:217, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer