human-f172a

 
Homo sapiens (Human). Protein FAM172A

Relationship
Block X
Homo sapiens position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 21 more: AL136630, AK295879, AK296986
>3 UniProt links 3 more: Q8WUF8, A0A024RAL9, B4DHJ0
>3 UniProtTrembl links 7 more: Q8WUF8, B2R7C6, B4DJ14
>3 Interpro links 7 more: Q8WUF8, B2R7C6, B4DJ14
>3 Prodom links 7 more: Q8WUF8, B2R7C6, B4DJ14
>3 Pfam links 7 more: Q8WUF8, B2R7C6, B4DJ14
>3 PIRSF links 7 more: Q8WUF8, B2R7C6, B4DJ14
>3 SUPERFAM links 7 more: Q8WUF8, B2R7C6, B4DJ14
>3 QuickSwissBlast links 7 more: Q8WUF8, B2R7C6, B4DJ14
 
Sequence
Graphical view for this peptide sequence: human-f172a
Colored MSA for Arb2_FAM172A (raw)
MSISLSSLILLPIWINMAQIQQGGPDEKEKTTALKDLLSRIDLDELMKKD
EPPLDFPDTLEGFEYAFNEKGQLRHIKTGEPFVFNYREDLHRWNQKRYEA
LGEIITKYVYELLEKDCNLKKVSIPVDATESEPKSFIFMSEDALTNPQKL
MVLIHGSGVVRAGQWARRLIINEDLDSGTQIPFIKRAVAEGYGVIVLNPN
ENYIEVEKPKIHVQSSSDSSDEPAEKRERKDKVSKETKKRRDFYEKYRNP
QREKEMMQLYIRENGSPEEHAIYVWDHFIAQAAAENVFFVAHSYGGLAFV
ELMIQREADVKNKVTAVALTDSVHNVWHQEAGKTIREWMRENCCNWVSSS
EPLDTSVESMLPDCPRVSAGTDRHELTSWKSFPSIFKFFTEASEAKTSSL
KPAVTRRSHRIKHEEL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSISLSSLILLPIWINMAQIQQGGPDEKEKTTALKDLLSRIDLDELMKKD
EPPLDFPDTLEGFEYAFNEKGQLRHIKTGEPFVFNYREDLHRWNQKRYEA
LGEIITKYVYELLEKDCNLKKVSIPVDATESEPKSFIFMSEDALTNPQKL
MVLIHGSGVVRAGQWARRLIINEDLDSGTQIPFIKRAVAEGYGVIVLNPN
ENYIEVEKPKIHVQSSSDSSDEPAEKRERKDKVSKETKKRRDFYEKYRNP
QREKEMMQLYIRENGSPEEHAIYVWDHFIAQAAAENVFFVAHSYGGLAFV
ELMIQREADVKNKVTAVALTDSVHNVWHQEAGKTIREWMRENCCNWVSSS
EPLDTSVESMLPDCPRVSAGTDRHELTSWKSFPSIFKFFTEASEAKTSSL
KPAVTRRSHRIKHEEL

no DNA




References
1 more
    Title: [Effect of FAM172A protein on apoptosis and proliferation in HEK293 cells]
    Li LX, Zhou WB, Tao Z, Deng WJ, Liang WC, Yang ZH, Ye WW, Bao YQ, Jia WP, Hu RM
    Ref: Zhonghua Yi Xue Za Zhi, 90:2424, 2010 : PubMed

            

    Title: Identification of the novel protein FAM172A, and its up-regulation by high glucose in human aortic smooth muscle cells
    Li L, Dong X, Leong MC, Zhou W, Yang Z, Chen F, Bao Y, Jia W, Hu R
    Ref: Int J Mol Med, 26:483, 2010 : PubMed

            

    Title: [Molecular cloning of a novel gene, C5orf21 gene and its roles in diabetic macroangiopathy]
    Li LX, Tao Z, Dong XH, Liang WC, Yang ZH, Mou B, Bao YQ, Wang C, Jia WP, Hu RM
    Ref: Zhonghua Yi Xue Za Zhi, 89:2574, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer