(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Proteobacteria: NE > Gammaproteobacteria: NE > Legionellales: NE > Legionellaceae: NE > Legionella: NE > Legionella pneumophila: NE > Legionella pneumophila subsp. pneumophila: NE
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MIKIKENRMSQSNVIIVHGAYGHPFENWFNWMKTELESLGIECFVPQLPT PDGQELKNWLHVFNSTVSPMITHDTILIGHSLGSAFLLRWLEQANQSVFS TILAGSFIGTVGIQKFDKINESFFENGFDWHSIINKSKQFFCYHGSNDPY ISRSNFNFIANNLQARKIIISQGGHLNEAAGFSSFPQLLIQLKSLLGINY GKFI
We present the genomic sequence of Legionella pneumophila, the bacterial agent of Legionnaires' disease, a potentially fatal pneumonia acquired from aerosolized contaminated fresh water. The genome includes a 45-kilobase pair element that can exist in chromosomal and episomal forms, selective expansions of important gene families, genes for unexpected metabolic pathways, and previously unknown candidate virulence determinants. We highlight the genes that may account for Legionella's ability to survive in protozoa, mammalian macrophages, and inhospitable environmental niches and that may define new therapeutic targets.
