Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pea-RMS3

Pisum sativum (Garden pea) Strigolactone esterase, PsD14, RAMOSUS 3, RMS3

Comment
Involved in strigolactone signaling pathway. Functions downstream of strigolactone synthesis, as a component of hormone signaling and as an enzyme that participates in the conversion of strigolactones to the bioactive form. Binds and hydrolyzes the synthetic strigolactone analog GR24 and its enantiomers in vitro. Forms a stable covalent complex with the D-ring of strigolactone, which is essential for hormone bioactivity. The D-ring is attached to His-247 of the catalytic triad. The hydrolysis of strigolactone into a covalently linked intermediate molecule is required to trigger strigolactone signaling. This mechanism defines RMS3 as a non-canonical hormone receptor with dual functions to generate and sense the active form of strigolactone


Relationship
Family|RsbQ-like
Block| X
Position in NCBI Life Tree|Pisum sativum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > fabids: N E > Fabales: N E > Fabaceae: N E > Papilionoideae: N E > Fabeae: N E > Pisum: N E > Pisum sativum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





2 substrates: Contalactone, GR24
No inhibitor
3 Genbank : AMB61024, AMB61027, AMB61030
1 UniProt : A0A109QYD3
1 UniProt : A0A109QYD3
1 Interpro : A0A109QYD3
1 Prodom : A0A109QYD3
1 Pfam : A0A109QYD3
1 PIRSF : A0A109QYD3
1 SUPERFAM : A0A109QYD3
Sequence
Graphical view for this peptide sequence: pea-RMS3
Colored MSA for RsbQ-like (raw)
MGTPILDAFNVRVEGSGDKYLVFAHGFGTDQSAWQRVLPYFTRSYKVILY
DLVCAGSVNPDHFDFRRYTTLDAYVDDLLNILDSLHVTRCAYVGHSISAM
TGMLASIRRPELFSKLILIGASPRFLNDGENYHGGFEQGEIEHVFSAMEA
NYEAWVNGFAPLAVGADVPTAVREFSRTLFNMRPDISLFVSRTVFNSDLR
GILGLVNVPCCIMQTARDMSVPASVATYMKEHIGGKSTVQWLDTEGHLPH
LSAPSYLAHQLEIALSQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGTPILDAFNVRVEGSGDKYLVFAHGFGTDQSAWQRVLPYFTRSYKVILY
DLVCAGSVNPDHFDFRRYTTLDAYVDDLLNILDSLHVTRCAYVGHSISAM
TGMLASIRRPELFSKLILIGASPRFLNDGENYHGGFEQGEIEHVFSAMEA
NYEAWVNGFAPLAVGADVPTAVREFSRTLFNMRPDISLFVSRTVFNSDLR
GILGLVNVPCCIMQTARDMSVPASVATYMKEHIGGKSTVQWLDTEGHLPH
LSAPSYLAHQLEIALSQ


Reference
    Title: An histidine covalent receptor and butenolide complex mediates strigolactone perception
    de Saint Germain A, Clave G, Badet-Denisot MA, Pillot JP, Cornu D, Le Caer JP, Burger M, Pelissier F, Retailleau P and Boyer FD <4 more author(s)>
    Ref: Nat Chemical Biology, 12:787, 2016 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer