Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: phaan-a0a0l9uc60

Phaseolus angularis (Azuki bean) (Vigna angularis). Uncharacterized protein

Relationship
Family|Plant_lipase_EDS1-like
Block| L
Position in NCBI Life Tree|Phaseolus angularis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > fabids: N E > Fabales: N E > Fabaceae: N E > Papilionoideae: N E > Phaseoleae: N E > Vigna: N E > Vigna angularis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: phaan-a0a0l9uc60
Colored MSA for Plant_lipase_EDS1-like (raw)
MAGGSLGDNIGLKEDVIKRVCGLAFKAHKHKTQDKLYFYEKVQISSGTYH
VFSFSGSWDATEWFVNKPYGETKIDLTLFPSLRSIGNDEAALVNQGFAKR
FDHIFKATPFKSEVNKAIGDGKQVVFTGHSSGAAMAVFATFWTLEEYLNP
TKTQKPKPPFCVTFGSPLIGNHILSHASRRENWSRYFIHFVLRYDIVPRI
LLAPVSCIEKTFGSIFQSLNPKFKTSIQDSPQAAEFFSSVMRNTASVTSH
AACILMGSTNLLLETVANFVDLSPYRPFGTYIFCNGNGQLIVVKNSDAVL
QLLFHTAQLSDLAELPEVAKDSISQHLSYEAELEDSLGMQNIVYLEQLEQ
LPLSADGSDSDVATISAALDGLGLSTRARLCLRAAGELQKQKKKNEEKIS
KEFEDKAVASMRYLENYKTSCEVQKGTGYYDAFKVQKEENDFQANVKRLV
LAGVWDEVIEMLKRYELPDEFEGKKEWIQRGTNFRRLVEPLDIANYHRHL
KNEDTGPYMIRARPKRYRYSQRWLEHAKREPKAVPITESSFWAEVEELHS
WINSKKAFDEVRERVEQLQRDLKKWTDENELTKDTFSKDPSFIKFYEILP
PENKANITALLANVKGF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAGGSLGDNIGLKEDVIKRVCGLAFKAHKHKTQDKLYFYEKVQISSGTYH
VFSFSGSWDATEWFVNKPYGETKIDLTLFPSLRSIGNDEAALVNQGFAKR
FDHIFKATPFKSEVNKAIGDGKQVVFTGHSSGAAMAVFATFWTLEEYLNP
TKTQKPKPPFCVTFGSPLIGNHILSHASRRENWSRYFIHFVLRYDIVPRI
LLAPVSCIEKTFGSIFQSLNPKFKTSIQDSPQAAEFFSSVMRNTASVTSH
AACILMGSTNLLLETVANFVDLSPYRPFGTYIFCNGNGQLIVVKNSDAVL
QLLFHTAQLSDLAELPEVAKDSISQHLSYEAELEDSLGMQNIVYLEQLEQ
LPLSADGSDSDVATISAALDGLGLSTRARLCLRAAGELQKQKKKNEEKIS
KEFEDKAVASMRYLENYKTSCEVQKGTGYYDAFKVQKEENDFQANVKRLV
LAGVWDEVIEMLKRYELPDEFEGKKEWIQRGTNFRRLVEPLDIANYHRHL
KNEDTGPYMIRARPKRYRYSQRWLEHAKREPKAVPITESSFWAEVEELHS
WINSKKAFDEVRERVEQLQRDLKKWTDENELTKDTFSKDPSFIKFYEILP
PENKANITALLANVKGF


References
    Title: The power of single molecule real-time sequencing technology in the de novo assembly of a eukaryotic genome
    Sakai H, Naito K, Ogiso-Tanaka E, Takahashi Y, Iseki K, Muto C, Satou K, Teruya K, Shiroma A and Tomooka N <4 more author(s)>
    Ref: Sci Rep, 5:16780, 2015 : PubMed

            

    Title: Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication
    Yang K, Tian Z, Chen C, Luo L, Zhao B, Wang Z, Yu L, Li Y, Sun Y and Wan P <17 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 112:13213, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer