Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: plafa-MAL8P1.138

Plasmodium falciparum (isolate 3D7) PF3D7_0805000 hypothetical protein, conserved

Relationship
Family|ABHD17-depalmitoylase
Block| X
Position in NCBI Life Tree|Plasmodium falciparum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Alveolata: N E > Apicomplexa: N E > Aconoidasida: N E > Haemosporida: N E > Plasmodiidae: N E > Plasmodium: N E > Plasmodium (Laverania): N E > Plasmodium falciparum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
2 inhibitors: Sal-A-alkyne, Salinipostin-A
3 Genbank : AL844507, CAX64090, XP_002808813
1 UniProt : C0H4R4
1 UniProt : C0H4R4
1 Interpro : C0H4R4
1 Prodom : C0H4R4
1 Pfam : C0H4R4
1 PIRSF : C0H4R4
1 SUPERFAM : C0H4R4
Sequence
Graphical view for this peptide sequence: plafa-MAL8P1.138
Colored MSA for ABHD17-depalmitoylase (raw)
MGNVLNRIIFNGPTEGYYEKFDLDFIYIETENNEKVAAHFINRNAPLTIL
FCHGNGENVYMLYDYFYETSKIWNVNVFLYDYLGYGESTGTASEKNMYLS
GNAVYDYMVNTLKINPNSIVLYGKSIGSCAAVDIAIKRKVKGLILQSAIL
SLLNICFKTRFIFPFDSFCNIKRIKLIPCFVFFIHGTDDKIVPFYHGMCL
YEKCKFKVHPYWVVDGKHNDIELIENERFNENIYSTN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGNVLNRIIFNGPTEGYYEKFDLDFIYIETENNEKVAAHFINRNAPLTIL
FCHGNGENVYMLYDYFYETSKIWNVNVFLYDYLGYGESTGTASEKNMYLS
GNAVYDYMVNTLKINPNSIVLYGKSIGSCAAVDIAIKRKVKGLILQSAIL
SLLNICFKTRFIFPFDSFCNIKRIKLIPCFVFFIHGTDDKIVPFYHGMCL
YEKCKFKVHPYWVVDGKHNDIELIENERFNENIYSTN


Reference
    Title: Functional annotation of serine hydrolases in the asexual erythrocytic stage of Plasmodium falciparum
    Elahi R, Ray WK, Dapper C, Dalal S, Helm RF, Klemba M
    Ref: Sci Rep, 9:17532, 2019 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer