Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: promi-c2lfd0

Proteus mirabilis ATCC 29906 Lipase

Relationship
Family|Bacterial_lip_FamI.1
Block| L
Position in NCBI Life Tree|Proteus mirabilis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Morganellaceae: N E > Proteus: N E > Proteus mirabilis: N E


Molecular evidence
Database
No mutation
5 structures (e.g. : 3W9U, 4GW3, 4GXN... more)
No kinetic





No Substrate
No inhibitor
1 Genbank : EEI49517
>3 Structure links 2 more: 4HS9, 6JD9, 4GXN
>3 UniProt links 1 more: A0A379FFB1, B4EVM3, A0A1Z1SX23
>3 Interpro links 1 more: A0A379FFB1, B4EVM3, A0A1Z1SX23
>3 Prodom links 1 more: A0A379FFB1, B4EVM3, A0A1Z1SX23
>3 Pfam links 1 more: A0A379FFB1, B4EVM3, A0A1Z1SX23
>3 PIRSF links 1 more: A0A379FFB1, B4EVM3, A0A1Z1SX23
>3 SUPERFAM links 1 more: A0A379FFB1, B4EVM3, A0A1Z1SX23
Sequence
Graphical view for this peptide sequence: promi-c2lfd0
Colored MSA for Bacterial_lip_FamI.1 (raw)
MSTKYPIVLVHGLAGFNEIVGFPYFYGIADALRQDGHQVFTASLSAFNSN
EVRGKQLWQFVQTLLQETQAKKVNFIGHSQGPLACRYVAANYPDSVASVT
SINGVNHGSEIADLYRRIMRKDSIPEYIVEKVLNAFGTIISTFSGHRGDP
QDAIAALESLTTEQVTEFNNKYPQALPKIPGGEGDEIVNGVHYYCFGSYI
QGLIAGEKGNLLDPTHAAMRVLNTFFTEKQNDGLVGRSSMRLGKLIKDDY
AQDHIDMVNQVAGLVGYNEDIVAIYTQHAKYLASKQL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSTKYPIVLVHGLAGFNEIVGFPYFYGIADALRQDGHQVFTASLSAFNSN
EVRGKQLWQFVQTLLQETQAKKVNFIGHSQGPLACRYVAANYPDSVASVT
SINGVNHGSEIADLYRRIMRKDSIPEYIVEKVLNAFGTIISTFSGHRGDP
QDAIAALESLTTEQVTEFNNKYPQALPKIPGGEGDEIVNGVHYYCFGSYI
QGLIAGEKGNLLDPTHAAMRVLNTFFTEKQNDGLVGRSSMRLGKLIKDDY
AQDHIDMVNQVAGLVGYNEDIVAIYTQHAKYLASKQL


References
4 more
    Title: Directed evolution of a genetically encoded immobilized lipase for the efficient production of biodiesel from waste cooking oil
    Heater BS, Chan WS, Lee MM, Chan MK
    Ref: Biotechnol Biofuels, 12:165, 2019 : PubMed

            

    Title: Dieselzymes: development of a stable and methanol tolerant lipase for biodiesel production by directed evolution.
    Korman TP, Sahachartsiri B, Charbonneau DM, Huang GL, Beauregard M, Bowie JU
    Ref: Biotechnol Biofuels, 6:70, 2013 : PubMed

            

    Title: Crystal Structure of Proteus mirabilis Lipase, a Novel Lipase from the Proteus/Psychrophilic Subfamily of Lipase Family I.1
    Korman TP, Bowie JU
    Ref: PLoS ONE, 7:e52890, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer