Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: psyck-q1qbb9

Psychrobacter cryohalolentis, Psychrobacter sp., alpha/beta hydrolase fold

Comment
Other strains: Psychrobacter cryohalolentis (K5); Psychrobacter sp.G)


Relationship
Family|Haloalkane_dehalogenase-HLD1
Block| X
Position in NCBI Life Tree|Psychrobacter cryohalolentis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Psychrobacter: N E > Psychrobacter cryohalolentis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
6F9O: Crystal structure of cold-adapted haloalkane dehalogenase DpcA from Psychrobacter cryohalolentis K5
No kinetic





No Substrate
No inhibitor
3 Genbank : AAJC01000003, CP000323, CP006265
2 UniProt : Q1QBB9, T1EBJ3
1 Structure : 6F9O
2 UniProt : Q1QBB9, T1EBJ3
2 Interpro : Q1QBB9, T1EBJ3
2 Prodom : Q1QBB9, T1EBJ3
2 Pfam : Q1QBB9, T1EBJ3
2 PIRSF : Q1QBB9, T1EBJ3
2 SUPERFAM : Q1QBB9, T1EBJ3
Sequence
Graphical view for this peptide sequence: psyck-q1qbb9
Colored MSA for Haloalkane_dehalogenase-HLD1 (raw)
MKILRTPDSRFANLPDYNFDPHYLMVDDSEDSELRVHYLDEGPRDADPVL
LLHGEPSWCYLYRKMIPILTAAGHRVIAPDLPGFGRSDKPASRTDYTYQR
HVNWMQSVLDQLDLNNITLFCQDWGGLIGLRLVAENPDRFARVAAGNTML
PTGDHDLGEGFRKWQQFSQEIPQFHVGGTIKSGTVTKLSQAVIDAYNAPF
PDESYKEGARQFPLLVPSTPDDPASENNRAAWIELSKWTKPFITLFSDSD
PVTAGGDRIMQKIIPGTKGQAHTTIANGGHFLQEDQGEKVAKLLVQFIHD
NPR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKILRTPDSRFANLPDYNFDPHYLMVDDSEDSELRVHYLDEGPRDADPVL
LLHGEPSWCYLYRKMIPILTAAGHRVIAPDLPGFGRSDKPASRTDYTYQR
HVNWMQSVLDQLDLNNITLFCQDWGGLIGLRLVAENPDRFARVAAGNTML
PTGDHDLGEGFRKWQQFSQEIPQFHVGGTIKSGTVTKLSQAVIDAYNAPF
PDESYKEGARQFPLLVPSTPDDPASENNRAAWIELSKWTKPFITLFSDSD
PVTAGGDRIMQKIIPGTKGQAHTTIANGGHFLQEDQGEKVAKLLVQFIHD
NPR


References
1 more
    Title: Crystal structure of the cold-adapted haloalkane dehalogenase DpcA from Psychrobacter cryohalolentis K5
    Tratsiak K, Prudnikova T, Drienovska I, Damborsky J, Brynda J, Pachl P, Kuty M, Chaloupkova R, Rezacova P, Kuta Smatanova I
    Ref: Acta Crystallographica F Struct Biol Commun, 75:324, 2019 : PubMed

            

    Title: Complete Genome Sequence of Antarctic Bacterium Psychrobacter sp. Strain G
    Che S, Song L, Song W, Yang M, Liu G, Lin X
    Ref: Genome Announc, 1:, 2013 : PubMed

            

    Title: Biochemical characterization of a novel haloalkane dehalogenase from a cold-adapted bacterium
    Drienovska I, Chovancova E, Koudelakova T, Damborsky J, Chaloupkova R
    Ref: Applied Environmental Microbiology, 78:4995, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer