Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: rabit-1cxes

Oryctolagus cuniculus protein for liver 60 kD carboxylesterase 1

Comment
There are variant sequences from cDNA by Danks et al. EMBL AF036930: go to protein and WGFFSTGDEHSRGNWGHLDQVAAL -> GGFGFNIDELFLVAVN in Ozols. We included the sequence from the structure


Relationship
Family|Carb_B_Chordata
Block| C
Position in NCBI Life Tree|Oryctolagus cuniculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Lagomorpha: N E > Leporidae: N E > Oryctolagus: N E > Oryctolagus cuniculus: N E


Molecular evidence
Database
No mutation
1 structure:
1K4Y: Crystal Structure of Rabbit Liver Carboxylesterase in Complex with 4-piperidino-piperidine (leaving group of the hydrolysis of CPT11 to SN-38)
No kinetic





7 substrates (e.g. : Paranitrophenylbutyrate, Tributyrin, Tripropionin... more)
2 inhibitors: 4-piperidino-piperidine, Irinotecan
2 Genbank : AF036930, AAGW02052800
2 UniProt : P12337, G1SRL5
1 Ncbi-nid : 3219694
1 Ncbi-pid : 3219695
1 Structure : 1K4Y
2 UniProt : P12337, G1SRL5
2 Interpro : P12337, G1SRL5
2 Prodom : P12337, G1SRL5
2 Pfam : P12337, G1SRL5
2 PIRSF : P12337, G1SRL5
2 SUPERFAM : P12337, G1SRL5
Sequence
Graphical view for this peptide sequence: rabit-1cxes
Colored MSA for Carb_B_Chordata (raw)
MWLRALVLATLAAFTAWGHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAVF
LGVPFAKPPLGSLRFAPPQPAESWSHVKNTTSYPPMCSQDAVSGHMLSEL
FTNRKENIPLKFSEDCLYLNIYTPADLTKRGRLPVMVWIHGGGLMVGGAS
TYDGLALSAHENVVVVTIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALRW
VQDNIANFGGDPGSVTIFGESAGGQSVSILLLSPLTKNLFHRAISESGVA
LLSSLFRKNTKSLAEKIAIEAGCKTTTSAVMVHCLRQKTEEELMEVTLKM
KFMALDLVGDPKENTAFLTTVIDGVLLPKAPAEILAEKKYNMLPYMVGIN
QQEFGWIIPMQMLGYPLSEGKLDQKTATELLWKSYPIVNVSKELTPVATE
KYLGGTDDPVKKKDLFLDMLADLLFGVPSVNVARHHRDAGAPTYMYEYRY
RPSFSSDMRPKTVIGDHGDEIFSVLGAPFLKEGATEEEIKLSKMVMKYWA
NFARNGNPNGEGLPQWPAYDYKEGYLQIGATTQAAQKLKDKEVAFWTELW
AKEAARPRETEHIEL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MWLRALVLATLAAFTAWGHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAVF
LGVPFAKPPLGSLRFAPPQPAESWSHVKNTTSYPPMCSQDAVSGHMLSEL
FTNRKENIPLKFSEDCLYLNIYTPADLTKRGRLPVMVWIHGGGLMVGGAS
TYDGLALSAHENVVVVTIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALRW
VQDNIANFGGDPGSVTIFGESAGGQSVSILLLSPLTKNLFHRAISESGVA
LLSSLFRKNTKSLAEKIAIEAGCKTTTSAVMVHCLRQKTEEELMEVTLKM
KFMALDLVGDPKENTAFLTTVIDGVLLPKAPAEILAEKKYNMLPYMVGIN
QQEFGWIIPMQMLGYPLSEGKLDQKTATELLWKSYPIVNVSKELTPVATE
KYLGGTDDPVKKKDLFLDMLADLLFGVPSVNVARHHRDAGAPTYMYEYRY
RPSFSSDMRPKTVIGDHGDEIFSVLGAPFLKEGATEEEIKLSKMVMKYWA
NFARNGNPNGEGLPQWPAYDYKEGYLQIGATTQAAQKLKDKEVAFWTELW
AKEAARPRETEHIEL


References
2 more
    Title: Overexpression of a rabbit liver carboxylesterase sensitizes human tumor cells to CPT-11
    Danks MK, Morton CL, Pawlik CA, Potter PM
    Ref: Cancer Research, 58:20, 1998 : PubMed

            

    Title: Isolation and partial characterization of a cDNA encoding a rabbit liver carboxylesterase that activates the prodrug irinotecan (CPT-11)
    Potter PM, Pawlik CA, Morton CL, Naeve CW, Danks MK
    Ref: Cancer Research, 58:2646, 1998 : PubMed

            

    Title: Isolation and characterization of a 60-kilodalton glycoprotein esterase from liver microsomal membranes
    Ozols J
    Ref: Journal of Biological Chemistry, 262 (31):15316, 1987 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer