Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: rhibe-a0a2k6jwp8

Rhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti) Rhinopithecus roxellana. Abhydrolase domain containing 16A

Comment
Other strains: Rhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti); Rhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)


Relationship
Family|ABHD16
Block| X
Position in NCBI Life Tree|Rhinopithecus bieti
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Cercopithecoidea: N E > Cercopithecidae: N E > Colobinae: N E > Rhinopithecus: N E > Rhinopithecus bieti: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: rhibe-a0a2k6jwp8
Colored MSA for ABHD16 (raw)
MAKLLSCVLGPRLYKIYRERDSERAPASVPETPTAVTAPHSSSWDTYYQP
RALEKHADSILALASVFWSISYYSSPFAFFYLYRKGYLSLSKVVPFSHYA
GTLLLLLAGVACLRGIGRWTNPQYRQFITILEATHRNQSSENKRQLAKYN
FDFRSWPVDFHWEEPSSRKESRGGPSRRGVALLRPEPLHRGTADTLLNRV
KKLPCQIASYLVAHTLGRRMLYPGSVYLLQKALMPVLLQGQARLVEECNG
RRAKLLACDGNEIDTMFVDRRGTAEPQGQKLVICCEGNAGFYEVGCISTP
LEAGYSVLGWNHPGFAGSTGVPFPQNEANAMDVVVQFAIHRLGFQPQDII
IYAWSIGGFTATWAAMSYPDVSAVILDASFDDLVPLALKVMPDSWRGLVT
RTVRQHLNLNNAEQLCRYLGPVLLIRRTKDEIITTTVPEDIMSNRGNDLL
LKLLQHRYPRVMAEEGLQVVRQWLEASSQLEEASIYSRWEVEEDWCLSVL
RSYQAEHGPDFPWSVGEDMSADGRRQLALFLARKHLHNFEATHCTPLPAQ
NFQMPWHL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAKLLSCVLGPRLYKIYRERDSERAPASVPETPTAVTAPHSSSWDTYYQP
RALEKHADSILALASVFWSISYYSSPFAFFYLYRKGYLSLSKVVPFSHYA
GTLLLLLAGVACLRGIGRWTNPQYRQFITILEATHRNQSSENKRQLAKYN
FDFRSWPVDFHWEEPSSRKESRGGPSRRGVALLRPEPLHRGTADTLLNRV
KKLPCQIASYLVAHTLGRRMLYPGSVYLLQKALMPVLLQGQARLVEECNG
RRAKLLACDGNEIDTMFVDRRGTAEPQGQKLVICCEGNAGFYEVGCISTP
LEAGYSVLGWNHPGFAGSTGVPFPQNEANAMDVVVQFAIHRLGFQPQDII
IYAWSIGGFTATWAAMSYPDVSAVILDASFDDLVPLALKVMPDSWRGLVT
RTVRQHLNLNNAEQLCRYLGPVLLIRRTKDEIITTTVPEDIMSNRGNDLL
LKLLQHRYPRVMAEEGLQVVRQWLEASSQLEEASIYSRWEVEEDWCLSVL
RSYQAEHGPDFPWSVGEDMSADGRRQLALFLARKHLHNFEATHCTPLPAQ
NFQMPWHL


Reference
    Title: Whole-genome sequencing of the snub-nosed monkey provides insights into folivory and evolutionary history
    Zhou X, Wang B, Pan Q, Zhang J, Kumar S, Sun X, Liu Z, Pan H, Lin Y and Li R <24 more author(s)>
    Ref: Nat Genet, 46:1303, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer