Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: sacen-a4f9k7

Saccharopolyspora erythraea para-nitrobenzyl esterase (EC 3.1.1.1)

Comment
Other strains: Saccharopolyspora erythraea (strains NRRL 23338; D)


Relationship
Family|Carb_B_Bacteria
Block| C
Position in NCBI Life Tree|Saccharopolyspora erythraea
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Pseudonocardiales: N E > Pseudonocardiaceae: N E > Saccharopolyspora: N E > Saccharopolyspora erythraea: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AM420293, AVCN01000010
1 UniProt : A4F9K7
1 UniProt : A4F9K7
1 Interpro : A4F9K7
1 Prodom : A4F9K7
1 Pfam : A4F9K7
1 PIRSF : A4F9K7
1 SUPERFAM : A4F9K7
Sequence
Graphical view for this peptide sequence: sacen-a4f9k7
Colored MSA for Carb_B_Bacteria (raw)
MNDAIVELDSGRVRGRVLDDHRVFQGIPYAAPPVGGLRWRSPQPVQPWAD
VLDATEPGSPCPQTAQVFAAIESLDEDCLNLNVTTPGTPGPKPVMVWLHG
GGGANGEGAIFDAHRLAVREDVVVVTPNSRLGIFGCFGYPGLEGSGGFGI
EDQQAALRWVRRNIAAFGGDPGNVTLFGESYGGFNIGAHLASPSSRGLFH
RAVLQSGFTLMDAPAGTWLPGTPALPTMWLSTAELHGLAAHFVEQSGWLD
PGSELTAVEQLRRVPVSELLELSSYFTRPAYGNAVLPESPDEAVRAGRFN
RVPAVVGGTRDEARLFVGLFFDLAGQPVTAEGYSRLLGEAFGPQAAQVER
EYPLSDYDTPSLAWAQVAEDRAWARSTWDLAHALASHTPTYCYEFADRDA
PPIVPFPEGFPPGAHHSAEVAYQFDLGEPAALSGEQWRLAEQINAYWANF
ARSGDPGSPDLPAWNRFEPADPYVQALAPGRTGPTDFAAGHRLDLWEKLR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNDAIVELDSGRVRGRVLDDHRVFQGIPYAAPPVGGLRWRSPQPVQPWAD
VLDATEPGSPCPQTAQVFAAIESLDEDCLNLNVTTPGTPGPKPVMVWLHG
GGGANGEGAIFDAHRLAVREDVVVVTPNSRLGIFGCFGYPGLEGSGGFGI
EDQQAALRWVRRNIAAFGGDPGNVTLFGESYGGFNIGAHLASPSSRGLFH
RAVLQSGFTLMDAPAGTWLPGTPALPTMWLSTAELHGLAAHFVEQSGWLD
PGSELTAVEQLRRVPVSELLELSSYFTRPAYGNAVLPESPDEAVRAGRFN
RVPAVVGGTRDEARLFVGLFFDLAGQPVTAEGYSRLLGEAFGPQAAQVER
EYPLSDYDTPSLAWAQVAEDRAWARSTWDLAHALASHTPTYCYEFADRDA
PPIVPFPEGFPPGAHHSAEVAYQFDLGEPAALSGEQWRLAEQINAYWANF
ARSGDPGSPDLPAWNRFEPADPYVQALAPGRTGPTDFAAGHRLDLWEKLR


References
    Title: Genome Sequence of Saccharopolyspora erythraea D, a Hyperproducer of Erythromycin
    Liu WB, Yu WB, Gao SH, Ye BC
    Ref: Genome Announc, 1:, 2013 : PubMed

            

    Title: Complete genome sequence of the erythromycin-producing bacterium Saccharopolyspora erythraea NRRL23338
    Oliynyk M, Samborskyy M, Lester JB, Mironenko T, Scott N, Dickens S, Haydock SF, Leadlay PF
    Ref: Nat Biotechnol, 25:447, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer