shidy-IROD

 
Shigella dysenteriae (strains serotype 1 Sd197; 1617) putative ferric enterochelin esterase. irod protein

Comment
Shigella dysenteriae irod 1 aa different


Relationship
Block X
Shigella dysenteriae position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Enterobacteriaceae: N E > Shigella: N E > Shigella dysenteriae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



2 UniProt : Q67DV2, Q32HL6
2 UniProtTrembl : Q67DV2, Q32HL6
2 Interpro : Q67DV2, Q32HL6
2 Prodom : Q67DV2, Q32HL6
2 Pfam : Q67DV2, Q32HL6
2 PIRSF : Q67DV2, Q32HL6
2 SUPERFAM : Q67DV2, Q32HL6
2 QuickSwissBlast : Q67DV2, Q32HL6
 
Sequence
Graphical view for this peptide sequence: shidy-IROD
Colored MSA for A85-IroE-IroD-Fes-Yiel (raw)
MLNMQQHPSAIASLRNQLAAGHIANLTDFWREAESLNVPLVTPVEGAEDE
REVTFLWRARHPLQGVYLRLNRVTDKEHVEKGMMSALPETDIWTLTLRLP
ASYCGSYSLLEIPPGTTAETIALSGGRFATLAGKADPLNKMPEINVRGNA
KESVLTLDKAPALSEWNGGFHTGQLLTSMRIIAGKSRQVRLYIPDVDISQ
PLGLVVLPDGETWFDHLGVCAAIDAAINNGRIVPVAVLGIDNINEHERTE
ILGGRSKLIKDIAEHLLPMIRAEQPQRQWADRSRTVLAGQSLGGISALMG
ARYAPETFGLVLSHSPSMWWTPERTSRPSLFSETDTSWVSEHLLSAPPQG
VRISLCVGSLEGSTVPHVQQLHQRLITAGVESHCAIYTGGHDYAWWRGAL
IDGIGLLQG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLNMQQHPSAIASLRNQLAAGHIANLTDFWREAESLNVPLVTPVEGAEDE
REVTFLWRARHPLQGVYLRLNRVTDKEHVEKGMMSALPETDIWTLTLRLP
ASYCGSYSLLEIPPGTTAETIALSGGRFATLAGKADPLNKMPEINVRGNA
KESVLTLDKAPALSEWNGGFHTGQLLTSMRIIAGKSRQVRLYIPDVDISQ
PLGLVVLPDGETWFDHLGVCAAIDAAINNGRIVPVAVLGIDNINEHERTE
ILGGRSKLIKDIAEHLLPMIRAEQPQRQWADRSRTVLAGQSLGGISALMG
ARYAPETFGLVLSHSPSMWWTPERTSRPSLFSETDTSWVSEHLLSAPPQG
VRISLCVGSLEGSTVPHVQQLHQRLITAGVESHCAIYTGGHDYAWWRGAL
IDGIGLLQG

no DNA




Reference
    Title: Genome dynamics and diversity of Shigella species, the etiologic agents of bacillary dysentery
    Yang F, Yang J, Zhang X, Chen L, Jiang Y, Yan Y, Tang X, Wang J, Xiong Z and Jin Q <17 more author(s)>
    Ref: Nucleic Acids Research, 33:6445, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer